Align Cyclohexadienyl dehydrogenase and ADH prephenate dehydrogenase (characterized, see rationale)
to candidate WP_011938378.1 GURA_RS07440 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= uniprot:Q92MG1 (307 letters) >NCBI__GCF_000016745.1:WP_011938378.1 Length = 286 Score = 261 bits (668), Expect = 1e-74 Identities = 138/282 (48%), Positives = 186/282 (65%), Gaps = 1/282 (0%) Query: 6 QTIALIGIGLIGSSIARDIREKQLAGTIVVTTRSEATLKRAGELGLGDRYTLSAAEAVEG 65 Q +A+IG+GLIG S+AR +REK IV R EA L++A ELG+ DRY+L VEG Sbjct: 5 QRLAIIGVGLIGGSLARILREKGAVVEIVGIGRGEANLRKAVELGVIDRYSLDPVAGVEG 64 Query: 66 ADLVVVSVPVGASGAVAAEIAAHLKPGAIVTDVGSTKGSVIAQMAPHLPKDVHFVPGHPI 125 ADLV ++ PV + + A IA L PG +VTD GS KG ++A LP FV GHPI Sbjct: 65 ADLVFLATPVCSIIDMVARIAPALAPGCVVTDGGSVKGEIVAPCEKLLPPGTFFVGGHPI 124 Query: 126 AGTEHSGPDAGFAGLFRGRWCILTPPAGTDEEAVARLRLFWETLGSMVDEMDPKHHDKVL 185 AGTE SG +A FA L++G+ CILTP A TD EA+ ++ WE GS V MD + HD+V+ Sbjct: 125 AGTEKSGVEASFAALYQGKRCILTPTAQTDGEALRKVVRMWELAGSEVVCMDVEKHDRVV 184 Query: 186 AIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDVCLHNKD 245 A +SHLPH++AY++V + +E+ ++KYSA GFRDFTR+A+SDP MWRD+ L N++ Sbjct: 185 AAISHLPHMVAYSLVNAVGGYDRFSEN-ILKYSAGGFRDFTRIASSDPAMWRDIALMNRE 243 Query: 246 AILEMLARFSEDLASLQRAIRWGDGDKLFDLFTRTRAIRRSI 287 A+LEM+ FSE A L+ + GDG L F R++ R +I Sbjct: 244 AVLEMMDFFSEYFAGLRNLVEKGDGHGLEAFFARSKQNRDAI 285 Lambda K H 0.320 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 286 Length adjustment: 26 Effective length of query: 281 Effective length of database: 260 Effective search space: 73060 Effective search space used: 73060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 12 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory