Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate WP_011939393.1 GURA_RS12870 TrpB-like pyridoxal phosphate-dependent enzyme
Query= uniprot:P50383 (425 letters) >NCBI__GCF_000016745.1:WP_011939393.1 Length = 434 Score = 404 bits (1038), Expect = e-117 Identities = 206/414 (49%), Positives = 277/414 (66%), Gaps = 4/414 (0%) Query: 8 LPKYWYNIIPDLPKPLPPPRDPQGAYFSRIDLLRSILPKEVLRQQFTIERYIKIPEEVRD 67 +P+ WYN DLP+ LPPPRDP+G SRI +R I PK + Q ER++ IPEE+ + Sbjct: 13 VPRRWYNSRKDLPEELPPPRDPEGTD-SRIQKIREITPKTLQEQDVMEERWLDIPEEILE 71 Query: 68 RYLSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHV 127 +YL IGRPTPL+RA+ LE YL TPARIYFK E TGS K NT++ QAY+ K+EG + V Sbjct: 72 KYLVIGRPTPLYRARNLERYLDTPARIYFKREDLLCTGSFKPNTSLAQAYYVKKEGYKGV 131 Query: 128 VTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEY 187 VT+TGAGQWGT+VALA + Y + T+FM +VS+ QKP RR Q++GA SP+ T+ Sbjct: 132 VTQTGAGQWGTSVALACAQYGLSCTVFMPEVSFNQKPYRRIHSQIFGAEFLPSPSRHTKS 191 Query: 188 GRKILETNPQHPGSLGIAMSEAIEYALKNE-FRYLVGSVLDVVLLHQSVIGQETITQLDL 246 GR +LE P HPGS+ +S+A+E+A++NE YL GS LLH +VIG ET QL L Sbjct: 192 GRALLEKMPDHPGSVNSGISDALEFAMENEGICYLNGSNAMHTLLHNTVIGLETEVQLKL 251 Query: 247 LGEDADILIGCVGGGSNFGGFTYPFIGNK--KGKRYIAVSSAEIPKFSKGEYKYDFPDSA 304 GE D+LI CVGGGSN GGF PF+ ++ R++AV S P+ ++G Y+Y+ D Sbjct: 252 AGEKPDVLIACVGGGSNLGGFMMPFLKDRLQNKLRFLAVESTAAPRLTQGTYRYEHGDPG 311 Query: 305 GLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVEWREYNEREIFEAAKIF 364 L PL K TLG D+VPP ++ GGLR HG +P +SLL G +E Y + ++F +IF Sbjct: 312 KLTPLNKAYTLGTDFVPPRMHVGGLRQHGGSPLVSLLRHLGYLEAVAYEQSDVFACGRIF 371 Query: 365 IENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGLLDLSNYESMM 418 + +GI+PAPE+ HAI+ V EA EA++ + +VIV SGHG LDL YE+++ Sbjct: 372 TKVEGILPAPETCHAIKGVFHEAYEAKEEGKERVIVACFSGHGFLDLEGYEAVL 425 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 434 Length adjustment: 32 Effective length of query: 393 Effective length of database: 402 Effective search space: 157986 Effective search space used: 157986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory