Align O-acetylhomoserine aminocarboxypropyltransferase (EC 2.5.1.49) (characterized)
to candidate WP_011940073.1 GURA_RS16550 homocysteine synthase
Query= BRENDA::P94890 (442 letters) >NCBI__GCF_000016745.1:WP_011940073.1 Length = 428 Score = 560 bits (1444), Expect = e-164 Identities = 269/428 (62%), Positives = 341/428 (79%), Gaps = 9/428 (2%) Query: 13 FKPETIALHGGQEPDPTTTSRAVPLYQTTSYVFKDTDHAARLFGLQEFGNIYTRLMNPTT 72 F +T+ALH GQ PDPTT SRAVP+YQT+SYVFK ++HAA LFGL+EFGNIYTR+MNPTT Sbjct: 6 FNFDTLALHAGQTPDPTTLSRAVPIYQTSSYVFKSSEHAANLFGLKEFGNIYTRIMNPTT 65 Query: 73 DVLEKRVAALEGGVAALATASGQSAEMLALLNIVEAGQEIVASSSLYGGTYNLLHYTFPK 132 DVLE+R+A L+GGV ALA ASGQ+A A+LNI +AGQ IV+++ LYGGTYNL HYT PK Sbjct: 66 DVLEQRMAQLDGGVGALAVASGQAAISYAVLNITQAGQNIVSTNYLYGGTYNLFHYTLPK 125 Query: 133 LGIKVHFVDQSDPENFRKASNDKTRAFYAETLGNPKLDTLDIAAVSKVAKEVGVPLVIDN 192 LGI V FVD SDPEN R+A +DKTR Y+E++GNPK + D A++++A G+P V+DN Sbjct: 126 LGIMVKFVDTSDPENVRRAIDDKTRLVYSESVGNPKNNVDDFEAIAQIAHAAGIPFVVDN 185 Query: 193 TMPSPYLVNPLKHGADIVVHSLTKFLGGHGTSIGGIIIDGGSFNWGNGKFKNFTEPDPSY 252 T+ +PYL PL+HGADIV +SLTKF+GGHGTSIGG ++DGG F W NGKF FTEPDPSY Sbjct: 186 TVTTPYLFKPLEHGADIVAYSLTKFIGGHGTSIGGCVVDGGKFPWNNGKFPEFTEPDPSY 245 Query: 253 HGLKFWEVFGKFEPFGGVNIAFILKARVQGLRDLGPAISPFNAWQILQGVETLPLRMERH 312 HGLK+WE G N+++I+K RV LRD+G A+SPFNA+Q + G+ETL +RM RH Sbjct: 246 HGLKYWEALG--------NLSYIIKMRVSLLRDMGAALSPFNAFQFILGLETLHVRMPRH 297 Query: 313 SGNALKVAEFLQKHPKIEWVNYPGLSTDKNYATAKKYHERGLFGAIVGFEIKGGVEKAKK 372 NA KVAE+L+K+P + WVNYPGL++ K+YA A+KY +G GAI+GF IKGGVE K+ Sbjct: 298 VENAQKVAEWLEKNPLVTWVNYPGLASHKDYARARKYLTKGA-GAIIGFGIKGGVEAGKR 356 Query: 373 FIDGLELFSLLANIGDAKSLAIHPASTTHQQLTGPEQISAGVTPGFVRLSVGLENIDDIL 432 FID ++L S LANIGDAKSL IHPASTTHQQL+ EQ+++GVT F+RLS+G+E+ DI+ Sbjct: 357 FIDNVKLLSHLANIGDAKSLVIHPASTTHQQLSEAEQLASGVTADFIRLSIGIEDAGDIM 416 Query: 433 VDLEEALK 440 D+++ALK Sbjct: 417 ADIDQALK 424 Lambda K H 0.317 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 428 Length adjustment: 32 Effective length of query: 410 Effective length of database: 396 Effective search space: 162360 Effective search space used: 162360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 12 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory