Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_011940173.1 GURA_RS17085 inositol monophosphatase
Query= curated2:P56160 (259 letters) >NCBI__GCF_000016745.1:WP_011940173.1 Length = 273 Score = 117 bits (294), Expect = 2e-31 Identities = 80/251 (31%), Positives = 126/251 (50%), Gaps = 4/251 (1%) Query: 5 LQLALELAEKAGKLTLDYFGRRSLQVFSKRDDTPVTEADRNAEELIRQGISAKFPDDGLF 64 L +A+ A AG++ + + K + VTE D+ EELI I A PD + Sbjct: 5 LDIAIRAARAAGQMQKERLWSEH-DIEFKGEINLVTEVDKACEELIVGMIRAACPDHDIL 63 Query: 65 GEEFDEHPSGNGRRWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPALGELYQ 124 EE D +G +WIIDP+DGT +F HG P +GV IALEV+G ++LGV+ P + EL+ Sbjct: 64 AEENDYAANGAACKWIIDPLDGTTNFAHGFPWFGVSIALEVDGVVRLGVVYHPMMDELFT 123 Query: 125 AERGSGAFMNGSPVQVSA--IAENSASTVVFTEKEYLLDPPSNHPVDQLRIDAGLVRGWG 182 A +G GAF+NG P+ VS +N F ++ + ++ A VR G Sbjct: 124 AVKGEGAFVNGRPLHVSVRQPLKNCLLATGFPYDRTWVNENNFDNFMNFQMCARAVRRAG 183 Query: 183 DCYGHM-LVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGEGLVSAN 241 + VA+GR + + + PWD AA +V EAGG ++ G + ++++N Sbjct: 184 AAALDLAYVAAGRLDGYWECKLKPWDVAAGQLLVAEAGGTVSNHAGDPFSVYDHRVLASN 243 Query: 242 NAMGRNLIAAI 252 + ++ + Sbjct: 244 GLIHAEMVEVL 254 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 273 Length adjustment: 25 Effective length of query: 234 Effective length of database: 248 Effective search space: 58032 Effective search space used: 58032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory