Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_011941019.1 GURA_RS21585 glutamate-1-semialdehyde 2,1-aminomutase
Query= curated2:Q9CC12 (404 letters) >NCBI__GCF_000016745.1:WP_011941019.1 Length = 427 Score = 145 bits (365), Expect = 3e-39 Identities = 99/314 (31%), Positives = 154/314 (49%), Gaps = 25/314 (7%) Query: 24 GTPPIVLASGNGAVVTDVDSNTYLDLLGGIAVNVLGHRHPAVIEAVTHQITTLGHTSNLY 83 GT P+ + +G+ + DVD N ++D +G +LGH HP V+ AV + S Sbjct: 32 GTDPLFIEKASGSRIYDVDGNEFIDYVGSWGPMILGHCHPQVVAAVKSAVDN--GCSFGA 89 Query: 84 ATEPSITLAEELVALLGADTQTRVFFCNSGTEANELAFKLSR-LTGRTKLVAAQAAFHGR 142 TE ITLAE ++ + + R+ +SGTEA A +L+R TGR K++ +HG Sbjct: 90 PTELEITLAEMVIEAVPSIEMVRMV--SSGTEATMSAIRLARGYTGRDKILKFSGCYHGH 147 Query: 143 TMGSLALTGQPAKQAAFEPLPG-------HVTHVPYGQVDA---LAAAVDNDTAAVFLEP 192 + L G A PG H Y +++ L A N + + +EP Sbjct: 148 SDSLLVKAGSGAATFGVPDSPGVPQDFAKHTLTATYNDLESVNKLVAENKNQISCIIVEP 207 Query: 193 IMGESGVIVPPEGYLAAARDITTRHGALLVIDEVQTGIGRTGAFFAHQHDSITPDVVTLA 252 + G G + P EG+L R + T G +L+ DEV +G R A + ++TPD+ TL Sbjct: 208 VAGNMGTVPPREGFLEGLRSLCTEEGIVLIFDEVMSGF-RVAYGGAQELYNVTPDMTTLG 266 Query: 253 KGLGGGLPIGAFLATGPAAELLTL-----GLH-GSTFGGNPVCTAAALAVLRVLATQGLV 306 K +GGGLP+GAF G E+++L G++ T GNP+ A + L++L T+G Sbjct: 267 KIIGGGLPVGAF---GGKKEIMSLLSPSGGVYQAGTLSGNPLAMTAGIETLKLLQTEGFY 323 Query: 307 RRAEVLGDSMRIGI 320 + + D + GI Sbjct: 324 QDLDRKSDYVASGI 337 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 15 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 427 Length adjustment: 31 Effective length of query: 373 Effective length of database: 396 Effective search space: 147708 Effective search space used: 147708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 12 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory