Align threonine ammonia-lyase (EC 4.3.1.19) (characterized)
to candidate WP_011951351.1 SWIT_RS02550 pyridoxal-5'-phosphate-dependent enzyme subunit beta
Query= BRENDA::Q74FW6 (402 letters) >NCBI__GCF_000016765.1:WP_011951351.1 Length = 318 Score = 178 bits (451), Expect = 2e-49 Identities = 111/277 (40%), Positives = 159/277 (57%), Gaps = 16/277 (5%) Query: 37 IYFKCENLQRTGAFKIRGALNFMTSQPREALAKGVITASAGNHAQGVAFSADLLGVPSTV 96 I+ K E LQ G+FK+R A N + + EA A+ V TASAGN AQG+A++ GV T Sbjct: 41 IHLKLETLQPVGSFKVRCAANALLRRV-EAGARDVSTASAGNFAQGLAYAGRERGVKVTA 99 Query: 97 FMPESTPPQKVFATRDYGAEVVLTGRNFDEAYAAAVQAQEERGALFVHPFDDPLVMAGQG 156 ++PE+ K+ R GA +V +D +A + ++ G F+HP DP V+AG G Sbjct: 100 YVPETAAESKLDGLRRLGAAIVALP--YDRWWAMLAEGSDDAG--FIHPVADPDVLAGNG 155 Query: 157 TIGLEVLQELPDVANILVPIGGGGLIAGIATAIRETHPHVRIIGVETAAAPSAHYSLQKG 216 TIGLE+L PD+A ++VP GGGGLI+GIA A++ + R+I ET A +L G Sbjct: 156 TIGLELLDARPDLAAVIVPYGGGGLISGIAAALKARGSNARVIACETEAGAPLRAALAAG 215 Query: 217 KIVQVPVTVTLADGIAVKKPG-----VNTFPIIRDLVDEVVLVEEEEIALAIVALLERTK 271 + PVT+ G V G +P +R LVD+ LV E A A+ L+ER Sbjct: 216 R----PVTIPFDSGSFVTGMGGPAVIPAMWPHVRALVDDTALVSLAETAAAVRLLVERHH 271 Query: 272 LLVEGAGAVPLAALLNRRVTDLSGKTVCVLSGGNIDV 308 L+ EGAGA P+AA L R+ + +G C++SGG++D+ Sbjct: 272 LIAEGAGAAPVAAALARQ--EAAGPVACIVSGGHLDL 306 Lambda K H 0.319 0.137 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 318 Length adjustment: 29 Effective length of query: 373 Effective length of database: 289 Effective search space: 107797 Effective search space used: 107797 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory