Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_011952251.1 SWIT_RS07135 acetylornithine transaminase
Query= reanno::Koxy:BWI76_RS11670 (406 letters) >NCBI__GCF_000016765.1:WP_011952251.1 Length = 396 Score = 339 bits (870), Expect = 7e-98 Identities = 175/388 (45%), Positives = 238/388 (61%), Gaps = 2/388 (0%) Query: 14 MMPVYAPAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAGKFWH 73 +MPVY PVRGEG L ++G+ Y+DFA GIAVN LGH HP LVKA+ +QA H Sbjct: 6 LMPVYPRCGVRPVRGEGCYLIGERGERYLDFASGIAVNILGHGHPDLVKAIADQAATLMH 65 Query: 74 TGNGYTNEPVLRLAKQLIDATFADRVFFCNSGAEANEAALKLARKYAHDRFGSEKSGIVA 133 T N Y + A++L+D TFAD VFF NSGAEA E A+K AR+Y + E++ I++ Sbjct: 66 TSNLYGSPQGEAFAQKLVDKTFADTVFFTNSGAEAVECAIKTARRYHYVNGSPERTKIIS 125 Query: 134 FKNAFHGRTLFTVSAGGQPAYSQDFAPLPPQIQHAIYNDLDSAKALIDDNTCAVIVEPMQ 193 F NAFHGRTL T+SA QP F PL P Q +NDL++A+A +D T +VEP+Q Sbjct: 126 FSNAFHGRTLGTISATSQPKMRDGFEPLLPGFQVVPFNDLEAARAAVDATTAGFLVEPVQ 185 Query: 194 GEGGVVPADADFLRGLRELCDAHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLSTAKA 253 GEGG+ P+ +FL+GLR++CD LLI DEVQ G RTG +A+ YG+TPD+++ AK Sbjct: 186 GEGGMTPSKPEFLKGLRQICDEQGLLLILDEVQCGYCRTGTFFAHEQYGITPDIMAVAKG 245 Query: 254 LGGGFPIGALLASERCASVMTVGTHGTTYGGNPLACAVAGEVFATINTREVLNGVKQRHQ 313 + GGFP+GA LA+E A M GTHG+TYGGNPLA A VF E L V+ Sbjct: 246 IAGGFPLGACLATEEAAKGMVFGTHGSTYGGNPLAMAAGEAVFKVAVNDEFLANVRATGD 305 Query: 314 WFCERLNAINARY-GLFKEIRGLGLLIGCVLKDEYAGKAKAISNQAAEEGLMILIAGANV 372 + + + + G+F +RGLGL+IG LKD +A +++ GL+ + AG NV Sbjct: 306 RLRQAIEQLIPNHDGVFDSVRGLGLMIGIKLKDAVEARA-FVAHLRDHHGLLTVAAGENV 364 Query: 373 VRFAPALIISEDEVNSGLDRFELACKRF 400 VR P L+I E + +++ + + Sbjct: 365 VRILPPLVIEESHIAECIEKLSAGARTY 392 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 396 Length adjustment: 31 Effective length of query: 375 Effective length of database: 365 Effective search space: 136875 Effective search space used: 136875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory