Align aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_011973901.1 MAEO_RS06050 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::O59096 (389 letters) >NCBI__GCF_000017185.1:WP_011973901.1 Length = 375 Score = 290 bits (743), Expect = 4e-83 Identities = 165/383 (43%), Positives = 232/383 (60%), Gaps = 24/383 (6%) Query: 3 LSDRLELVSASEIRKLFDIAAGMKDVISLGIGEPDFDTPQHIKEYAKEALDKGLTHYGPN 62 +S+R + + SEIRK+F++A KD I+LGIGEPDFDTPQHI E AK+ALD+G THY PN Sbjct: 2 ISNRCKNIEPSEIRKIFNMAT--KDSINLGIGEPDFDTPQHIVEGAKKALDEGKTHYTPN 59 Query: 63 IGLLELREAIAEKLKKQNGIEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFV 122 G+ ELREAI+ KLK N ++ D I+ GA++A ++ L + G+EVLI P FV Sbjct: 60 NGIPELREAISHKLKIDNNLDVD-ANNIITTCGASEALMLSLMTLVNKGDEVLISNPGFV 118 Query: 123 SYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDL 182 SY L G +P +++F ++++E+K +T+KT+ +++NSP NPTG V+ K ++ Sbjct: 119 SYNSLTQLCEGN--IIPMKLDEKFNIDIEEVKNSITNKTKCIMLNSPANPTGKVMDKSEI 176 Query: 183 EEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRL 242 + I D ++++I+ISDE+YE IY D +HYS + I +NGFSK+ AMTGWR+ Sbjct: 177 KAICDIAEDNNIIIISDEIYEKIIY-DKKHYSPMEFT---DNCILINGFSKSHAMTGWRI 232 Query: 243 GFVAAPS------WIIERMVKFQMYNATCPVTFIQYAAAKALKDERSWKAVEEMRKEYDR 296 G++ +IE M K Y C +F QY A +AL S V EM E+ R Sbjct: 233 GYIGINENLNKKYDLIENMTKIHQYGFACATSFAQYGALEALTG--SQNCVNEMLNEFRR 290 Query: 297 RRKLVWKRLNEMGLPTVKPKGAFYIFPRIR--DTGLTSKKFSELMLKEARVAVVPGSAFG 354 RR L+ L TV P GAFY+FP + D G+ + L E + VPG AFG Sbjct: 291 RRDLMVNGLKNTFKLTV-PDGAFYVFPNVEEYDNGMEISQ----KLIENNILCVPGIAFG 345 Query: 355 KAGEGYVRISYATAYEKLEEAMD 377 GE YVR SYAT YE +E+A++ Sbjct: 346 SGGENYVRFSYATKYEDIEKALE 368 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 29 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 375 Length adjustment: 30 Effective length of query: 359 Effective length of database: 345 Effective search space: 123855 Effective search space used: 123855 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory