Align 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) (characterized)
to candidate WP_011973909.1 MAEO_RS06090 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
Query= reanno::Cola:Echvi_2515 (239 letters) >NCBI__GCF_000017185.1:WP_011973909.1 Length = 241 Score = 161 bits (407), Expect = 1e-44 Identities = 94/234 (40%), Positives = 139/234 (59%), Gaps = 2/234 (0%) Query: 1 MEIIPAIDIIGGKCVRLTQGDYGQKKEYADNPLEVAKKFEGAGIKRLHLVDLDGAKAKTI 60 M +IPA+DI KCV+L QG+ +K DNPLEVA+K+ G + +HLVDLD A T Sbjct: 1 MIVIPAVDIKNKKCVQLIQGNPDKKHIELDNPLEVAEKWIKCGAEMIHLVDLDSAIYGTD 60 Query: 61 VNRAVLENITSHTSLKVDFGGGVQSDETIQMAFDAGASQVTGGSIAVKNPALFEGWLEKH 120 N+ ++ I + V+ GGGV++ E D GA +V G+ AVKNP + LEK Sbjct: 61 TNKETIKKIIESVPVPVEVGGGVRTVEDALNLIDLGAERVILGTSAVKNPEIITELLEKG 120 Query: 121 -GSEKIILGADAKNRKIAISGWEETTEADVVDFIKDYHAKGARYVICTDVAKDGLLQGPS 179 SEKI++ DAK+ K+ I GW E TE ++ K KGA ++ T+V +GLL G Sbjct: 121 INSEKIMVALDAKDGKVVIKGWMEKTEYTPIEIGKILEEKGAGSILFTNVDVEGLLDGID 180 Query: 180 VDLYREIIQEIPGIRLIASGGVAEVRDLEVLEKIGVFGTIVGKAFYEGRVSLEE 233 ++ ++++ E+ I +IASGG+ DL L++IGV G +VG A Y+ + L++ Sbjct: 181 IEPVKKLVDEL-NIPIIASGGITTYDDLLKLKEIGVDGVVVGSAIYKEMMDLKK 233 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 241 Length adjustment: 23 Effective length of query: 216 Effective length of database: 218 Effective search space: 47088 Effective search space used: 47088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_011973909.1 MAEO_RS06090 (1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase)
to HMM TIGR00007 (hisA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (EC 5.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00007.hmm # target sequence database: /tmp/gapView.20510.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00007 [M=231] Accession: TIGR00007 Description: TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-84 267.9 5.9 4.3e-84 267.7 5.9 1.0 1 lcl|NCBI__GCF_000017185.1:WP_011973909.1 MAEO_RS06090 1-(5-phosphoribosyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017185.1:WP_011973909.1 MAEO_RS06090 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamin # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 267.7 5.9 4.3e-84 4.3e-84 1 230 [. 3 233 .. 3 234 .. 0.99 Alignments for each domain: == domain 1 score: 267.7 bits; conditional E-value: 4.3e-84 TIGR00007 1 iiPaiDlkeGkvvrlvqGdkdkktvysddpleaakkfeeegaellHvVDLdgAkegekknlevikkive 69 +iPa+D+k+ k+v+l+qG++dkk+++ d+ple+a+k+ + gae++H+VDLd A+ g +n+e+ikki+e lcl|NCBI__GCF_000017185.1:WP_011973909.1 3 VIPAVDIKNKKCVQLIQGNPDKKHIELDNPLEVAEKWIKCGAEMIHLVDLDSAIYGTDTNKETIKKIIE 71 89******************************************************************* PP TIGR00007 70 elevkvqvGGGiRsleavekllelgverviigtaavenpelvkellke.lgsekivvslDakegevavk 137 ++ v+v+vGGG+R++e++ +l++lg+ervi+gt+av+npe+++ell++ ++seki+v+lDak+g+v++k lcl|NCBI__GCF_000017185.1:WP_011973909.1 72 SVPVPVEVGGGVRTVEDALNLIDLGAERVILGTSAVKNPEIITELLEKgINSEKIMVALDAKDGKVVIK 140 *********************************************98757889**************** PP TIGR00007 138 GWkekselslvelakkleelgleeiilTdiekdGtlsGvnveltkelvkeaeveviasGGvssiedvka 206 GW ek+e++++e+ k lee g+ +i++T+++++G l G+++e +k+lv+e ++++iasGG+++ +d+ + lcl|NCBI__GCF_000017185.1:WP_011973909.1 141 GWMEKTEYTPIEIGKILEEKGAGSILFTNVDVEGLLDGIDIEPVKKLVDELNIPIIASGGITTYDDLLK 209 ********************************************************************* PP TIGR00007 207 lkklgvkgvivGkAlyegklklke 230 lk++gv+gv+vG+A+y++ ++lk+ lcl|NCBI__GCF_000017185.1:WP_011973909.1 210 LKEIGVDGVVVGSAIYKEMMDLKK 233 ********************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (241 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.57 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory