Align N-acetyl-gamma-glutamyl-phosphate reductase; AGPR; EC 1.2.1.38; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase (uncharacterized)
to candidate WP_011974022.1 MAEO_RS06695 N-acetyl-gamma-glutamyl-phosphate reductase
Query= curated2:Q58496 (341 letters) >NCBI__GCF_000017185.1:WP_011974022.1 Length = 344 Score = 452 bits (1162), Expect = e-132 Identities = 228/346 (65%), Positives = 272/346 (78%), Gaps = 7/346 (2%) Query: 1 MKEVAIIGATGYTGAELLRLLANHEKVNVTYITSRKEAGKHVFKVHPHLKGIEKYKNLCF 60 M ++IIG TGYTG+ELLR+L NH +V + +ITSRK G ++ KVHP+LK I+ NL F Sbjct: 1 MVTISIIGGTGYTGSELLRILLNHPQVEIKHITSRKMDGVNITKVHPNLKNIKNIDNLVF 60 Query: 61 TG-DIDKVDAYLVFTATPHGASMDIVPDFIERGMKVIDLSGDYRFEDLSLYEKYYKIKHK 119 +D+ VF ATPHGASM IVP+ E G K+IDLSGDYRFEDLSLYEK+Y + H Sbjct: 61 ENISPSNLDSDFVFCATPHGASMKIVPELYETGSKIIDLSGDYRFEDLSLYEKWYNLTHT 120 Query: 120 GLPDVKIAYGLPELHREEIKEAQLVANPGCFPTGAILAVAPLVKENIIEERIIFDSKTGV 179 G ++ YGLPELHR EIK+AQLVANPGCFPTG+ILA+APLVKE IIE RII DSKTGV Sbjct: 121 G--ELPAVYGLPELHRNEIKKAQLVANPGCFPTGSILALAPLVKEGIIENRIIVDSKTGV 178 Query: 180 SGAGIKPTETTHFPNVNENINPYKITTHRHTPEIEKELKKL---GKAKVSFTPHLAPITR 236 SGAG+ P+ETTH+P+VNENI PYK+TTHRH+PEIEKEL+KL K+SFTPHLAP+TR Sbjct: 179 SGAGVNPSETTHYPSVNENILPYKMTTHRHSPEIEKELEKLNISNNIKLSFTPHLAPLTR 238 Query: 237 GILTTAHTFLAK-DVDREEIIKIYEKFYGSEVFVRIFSEEIPKLTWVRGTNFCDIGGFEI 295 GIL+T H++L D+DR+ II IY +FY +E FVRIF E P LT VRG+NFCDIGGFEI Sbjct: 239 GILSTTHSYLKNTDIDRDIIIDIYNEFYKNEPFVRIFEEGAPTLTGVRGSNFCDIGGFEI 298 Query: 296 DEHGRLVVISAIDNLVKGASGQAIQNMNIMFGFDEKEGLFDVGLNP 341 D HGR+VV+SAIDNLVKGASGQAI N+N+M GF+E E L GL P Sbjct: 299 DRHGRIVVVSAIDNLVKGASGQAIHNLNLMAGFNETESLLYGGLKP 344 Lambda K H 0.319 0.140 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 499 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 344 Length adjustment: 29 Effective length of query: 312 Effective length of database: 315 Effective search space: 98280 Effective search space used: 98280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_011974022.1 MAEO_RS06695 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.9848.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-132 427.7 0.0 2e-132 427.6 0.0 1.0 1 lcl|NCBI__GCF_000017185.1:WP_011974022.1 MAEO_RS06695 N-acetyl-gamma-glut Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017185.1:WP_011974022.1 MAEO_RS06695 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 427.6 0.0 2e-132 2e-132 2 345 .] 3 344 .] 2 344 .] 0.94 Alignments for each domain: == domain 1 score: 427.6 bits; conditional E-value: 2e-132 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvd.lkleeleeeeileead 69 +++i+G++GYtG eLlr+l +Hp+ve+++++s++ g ++++vhp+lk++ + +l ++++ + + d lcl|NCBI__GCF_000017185.1:WP_011974022.1 3 TISIIGGTGYTGSELLRILLNHPQVEIKHITSRKMDGVNITKVHPNLKNIKNiDNLVFENISPSNLDSD 71 789*************************6655555*************9988777777777666789** PP TIGR01850 70 vvflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreei 138 +vf+A+phg+s+++vpel+e+g k+idlS+d+R++d ++YekwY+ +h+ e avYGlpEl+r+ei lcl|NCBI__GCF_000017185.1:WP_011974022.1 72 FVFCATPHGASMKIVPELYETGSKIIDLSGDYRFEDLSLYEKWYNLTHTGE---LPAVYGLPELHRNEI 137 *************************************************95...68************* PP TIGR01850 139 kkaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvtk 207 kka+l+anPGC++T+++LalaPl+ke++ie+ +iivd+k+GvSgAG ++se+++++ vnen+ pYk+t+ lcl|NCBI__GCF_000017185.1:WP_011974022.1 138 KKAQLVANPGCFPTGSILALAPLVKEGIIEN-RIIVDSKTGVSGAGVNPSETTHYPSVNENILPYKMTT 205 ***************************9998.5************************************ PP TIGR01850 208 HrHtpEieqelsklaek.kvkvsftphlvpmtrGilatiyaklkke.lteeelrklyeevYedepfvrv 274 HrH pEie+el+kl+ + ++k+sftphl+p+trGil+t++ lk+ ++++ + ++y+e+Y++epfvr+ lcl|NCBI__GCF_000017185.1:WP_011974022.1 206 HRHSPEIEKELEKLNISnNIKLSFTPHLAPLTRGILSTTHSYLKNTdIDRDIIIDIYNEFYKNEPFVRI 274 *************99776899********************99987699999***************** PP TIGR01850 275 lkegelPstkavlgsnfvdig.vavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklp 342 ++ + +P+++ v+gsnf+dig +++d +++r+vvvsaiDNLvKGa+gqA+ nlNlm gf+ete+L + + lcl|NCBI__GCF_000017185.1:WP_011974022.1 275 FE-EGAPTLTGVRGSNFCDIGgFEID-RHGRIVVVSAIDNLVKGASGQAIHNLNLMAGFNETESLLYGG 341 *8.899***************55555.59************************************9877 PP TIGR01850 343 llp 345 l p lcl|NCBI__GCF_000017185.1:WP_011974022.1 342 LKP 344 765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (344 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.60 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory