Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_011988752.1 CKL_RS00760 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_000016505.1:WP_011988752.1 Length = 482 Score = 180 bits (456), Expect = 6e-50 Identities = 99/255 (38%), Positives = 153/255 (60%), Gaps = 6/255 (2%) Query: 8 LARLTDVIDRLLAPEGCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDVMF 67 L L D++++L + GCPWDKEQ +SL YL+EE +E+VE+I + ++ EE+GDV+ Sbjct: 229 LKDLLDIMEKLRSETGCPWDKEQNHDSLKKYLIEESYEVVESIEEKDDTKLVEELGDVLL 288 Query: 68 LLAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKRAEKA 127 + F ++ ++G F ++D + KMI+RHPHVF + + E L +W+ IK+ E+ Sbjct: 289 QVVFHCQIGKEEGFFNINDVIRAICDKMIKRHPHVFGNMKIHNSKEVLISWDKIKKKEQG 348 Query: 128 --DAEGEPQGVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELLDVL 185 E + V +LPA L++A+++ KAA+VGF W + E +V E+ E+ +V Sbjct: 349 LKTYTDELRHVAKTLPA----LMRAFKVQEKAAKVGFDWEKVEYALDKVLEEYYEVKEVY 404 Query: 186 AGDDKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARERGLDFP 245 G+ K E+GDLIF+ V + R I AL+ T KF+RRF +E +RE GLD Sbjct: 405 KGEQKVKILEEIGDLIFACVNVARFLDIDPEFALNYTIEKFIRRFAYIEKNSREHGLDMA 464 Query: 246 ALSLDDKDELWNEAK 260 ++LD+ DELW EAK Sbjct: 465 NMTLDEMDELWEEAK 479 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 482 Length adjustment: 29 Effective length of query: 238 Effective length of database: 453 Effective search space: 107814 Effective search space used: 107814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory