Align L-threonine ammonia-lyase; L-serine ammonia-lyase; Threonine dehydratase; EC 4.3.1.19; EC 4.3.1.17 (characterized)
to candidate WP_011988995.1 CKL_RS02105 threonine ammonia-lyase
Query= SwissProt::Q9WYJ1 (401 letters) >NCBI__GCF_000016505.1:WP_011988995.1 Length = 412 Score = 378 bits (970), Expect = e-109 Identities = 195/396 (49%), Positives = 273/396 (68%), Gaps = 1/396 (0%) Query: 2 ITLEDIKEAQRTLKNVVHRTALAYSSVLSEVTGGEIYLKMENLQKTGSFKIRGAYNKIAH 61 +TLED+ EA++ +K++ T L YSS S +G E+Y+K ENLQ TG+FK+RGA NKI+ Sbjct: 14 LTLEDVLEARKRIKDICIDTELIYSSEYSLESGNEVYIKPENLQITGAFKLRGALNKISK 73 Query: 62 LSEEERKRGVVAASAGNHAQGVALAAQIFGIPATIVMPRYAPLSKITKTRNLGAQVILEG 121 LSE+ +K+G++A+SAGNHAQGVA AA GI ATIVMP PL K+ T+N GA+V+L+G Sbjct: 74 LSEDNKKKGLIASSAGNHAQGVAYAANKLGIKATIVMPETTPLIKVQATKNYGAEVVLKG 133 Query: 122 NIFDEAYEAALRIQEKTGAVFVHPFNDPHVIAGQGTIGLEIMEDLPDVEVVVVPVGGGGL 181 ++DEAYE A R++++ G F+HPF+D V+AGQGTI LEI+E L DV+ +VVP+GGGGL Sbjct: 134 KVYDEAYEEAKRLEKEKGYTFIHPFDDLDVMAGQGTIALEIIEKLKDVDAIVVPIGGGGL 193 Query: 182 ISGVSVAIKSMNPEVKVIGVQTENMPSMIASLRRGRAERVEGKPTLADGIAVKKPGDLTF 241 ISG+SVA KS+NP +K+IGVQ + M S G+ E T+ADG AVK PG LTF Sbjct: 194 ISGISVAAKSINPNIKIIGVQADGANPMKYSFDTGKLTSAEDIDTIADGAAVKNPGKLTF 253 Query: 242 ELVKKYVDEMVAVNEEEIADAILFLLEQAKVVAEGAGAVGVAAVLNKLDVKGKKVAIVIS 301 ++VKKYVDE+V V+++++ + + LLE+ K+VAE GA+ +AA L+KL K KKV +IS Sbjct: 254 QVVKKYVDEIVTVSDQQLMEDVYILLEKHKLVAEATGAMSLAA-LSKLKFKNKKVVCLIS 312 Query: 302 GGNIDVNMIDRIINKGLVKSGRKVFIETFVMDRPGALKELLGIVAELGANVLSVFHNRSA 361 GGNIDV + ++N GLV GR + D PG L ++ I+AE AN++ + HN+ Sbjct: 313 GGNIDVVTMSALLNHGLVSRGRIFCFSVKLKDTPGQLLQISKILAEKSANIIKLDHNQFK 372 Query: 362 KEVPIGFAKIELELETVDEKHVEEIERVLIAKGYEV 397 + +E+ +ET H+EEI + L GY + Sbjct: 373 AIDRLKHVALEVTVETNGHDHIEEIIKSLNEHGYNI 408 Lambda K H 0.317 0.136 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 412 Length adjustment: 31 Effective length of query: 370 Effective length of database: 381 Effective search space: 140970 Effective search space used: 140970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_011988995.1 CKL_RS02105 (threonine ammonia-lyase)
to HMM TIGR01127 (ilvA: threonine ammonia-lyase (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01127.hmm # target sequence database: /tmp/gapView.26114.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01127 [M=380] Accession: TIGR01127 Description: ilvA_1Cterm: threonine ammonia-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-152 494.0 11.3 1.6e-152 493.8 11.3 1.0 1 lcl|NCBI__GCF_000016505.1:WP_011988995.1 CKL_RS02105 threonine ammonia-ly Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016505.1:WP_011988995.1 CKL_RS02105 threonine ammonia-lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 493.8 11.3 1.6e-152 1.6e-152 1 378 [. 33 408 .. 33 410 .. 0.99 Alignments for each domain: == domain 1 score: 493.8 bits; conditional E-value: 1.6e-152 TIGR01127 1 tpleksstlsditgaevylklenlqktGsfkirGalnkiaklseeekkrGvvaasaGnhaqGvalaakv 69 t l++ss +s + g evy+k enlq+tG+fk+rGalnki+klse++kk+G +a+saGnhaqGva+aa++ lcl|NCBI__GCF_000016505.1:WP_011988995.1 33 TELIYSSEYSLESGNEVYIKPENLQITGAFKLRGALNKISKLSEDNKKKGLIASSAGNHAQGVAYAANK 101 789****************************************************************** PP TIGR01127 70 fgikakivmPesaplskvkatksyGaeviLhGadfDeayklaeelaeeegrvfvhafdDefviaGqGtl 138 gika+ivmPe +pl kv+atk+yGaev+L+G+++Deay+ a++l++e+g++f+h+fdD v+aGqGt+ lcl|NCBI__GCF_000016505.1:WP_011988995.1 102 LGIKATIVMPETTPLIKVQATKNYGAEVVLKGKVYDEAYEEAKRLEKEKGYTFIHPFDDLDVMAGQGTI 170 ********************************************************************* PP TIGR01127 139 gleiledlpdvdtvivPvGGGGLisGvasavkklnpevkviGveaeaapslveslkegkikavesvkti 207 +lei+e+l dvd ++vP+GGGGLisG+++a+k++np++k+iGv+a++a+ ++ s++ gk +++e +ti lcl|NCBI__GCF_000016505.1:WP_011988995.1 171 ALEIIEKLKDVDAIVVPIGGGGLISGISVAAKSINPNIKIIGVQADGANPMKYSFDTGKLTSAEDIDTI 239 ********************************************************************* PP TIGR01127 208 aDGiavkkpgdltfeivkelvDevvavdeeeiakaillLlerakivaegaGavgvaavleekvdvkgkk 276 aDG avk+pg+ltf++vk++vDe+v+v+++++ + +++Lle++k+vae++Ga+++aa+ k++ k+kk lcl|NCBI__GCF_000016505.1:WP_011988995.1 240 ADGAAVKNPGKLTFQVVKKYVDEIVTVSDQQLMEDVYILLEKHKLVAEATGAMSLAALS--KLKFKNKK 306 *********************************************************95..58889999 PP TIGR01127 277 vavvvsGGnidlnllekiiekgLvksgrkvkietvlkDkPGaLkklleviaekranivkiehdrlskei 345 v+ ++sGGnid+ ++ ++++gLv++gr+ ++ lkD+PG+L ++ +++aek ani+k++h++++ lcl|NCBI__GCF_000016505.1:WP_011988995.1 307 VVCLISGGNIDVVTMSALLNHGLVSRGRIFCFSVKLKDTPGQLLQISKILAEKSANIIKLDHNQFKAID 375 *****************************************************************9999 PP TIGR01127 346 algaakvelelevkgkehleellktlrdkgyev 378 l +e+++e++g++h+ee+ k l+++gy++ lcl|NCBI__GCF_000016505.1:WP_011988995.1 376 RLKHVALEVTVETNGHDHIEEIIKSLNEHGYNI 408 9999***************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (380 nodes) Target sequences: 1 (412 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.52 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory