Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_011989272.1 CKL_RS03460 threonine synthase
Query= BRENDA::P16120 (514 letters) >NCBI__GCF_000016505.1:WP_011989272.1 Length = 496 Score = 270 bits (691), Expect = 7e-77 Identities = 180/523 (34%), Positives = 284/523 (54%), Gaps = 48/523 (9%) Query: 8 YRSTRSSSPKTISFEEAIIQGLATDGGLFIPPTIPQVDQATLFNDWSKLSFQDLAFAIMR 67 Y STR + K + AI+ G++ DGGLFIP TIP +D+ L +++++LA I+ Sbjct: 6 YNSTRGLN-KNFTASRAILNGISEDGGLFIPHTIPFIDEEEL-KKLKYMTYKELALCIIE 63 Query: 68 LYIAQEEIPDADLKDLIKRSYST-FRSDEVTPLVQNVTGDKENLHILELFHGPTYAFKDV 126 + + +LK+ I +Y F SD++ PL + GD + LELFHGPT AFKD+ Sbjct: 64 KFFT--DFSKEELKECIDLAYDNKFESDKIVPLEK--VGD---VFYLELFHGPTLAFKDM 116 Query: 127 ALQFVGNLFEYFLQRTNANLPEGEKKQITVVGATSGDTGSAAIYGLRGKKDVSVFILYPT 186 AL + +L + ++ + K+I ++ ATSGDTG AA+ G + + + +P Sbjct: 117 ALCLLPHLMKTAAKKQKLH------KEIVILTATSGDTGKAALEGFANVEGTKIVVFFPE 170 Query: 187 GRISPIQEEQMTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHN-----VGAVNS 241 +S IQ++QM T N + + + G FD+ Q VK IF D E + N + NS Sbjct: 171 QGVSKIQKKQMVTQQGGNTKVVGIEGNFDDAQSEVKKIFNDHELKEELNENSYRFSSANS 230 Query: 242 INWARILAQMTYYFYSFFQATNGKD---SKKVKFVVPSGNFGDILAGYFAKKMGLPIEKL 298 IN R++ Q+ YYFY + + + K+ F VP+GNFG+ILA Y+AKKMGLPI KL Sbjct: 231 INIGRLIPQVVYYFYGYMELLRRGEINFGNKINFSVPTGNFGNILAAYYAKKMGLPINKL 290 Query: 299 AIATNENDILDRFLKSGLYERSDKVAATLSPAMDILISSNFERLLWYLAREYLANGDDLK 358 A+NEN +L F ++G Y+ + T+SP+MDILISSN ERL++ ++ K Sbjct: 291 ICASNENRVLYDFFENGTYDAEREFILTISPSMDILISSNLERLIYDISG---------K 341 Query: 359 AGEIVNNWFQELKTNGKFQVDKSIIEGASKDFTSERVSNEETSETIKKIYESSVNPKHYI 418 +VN L + K+ V +S+ E K F S EET + IK+ +++ Y+ Sbjct: 342 DSTVVNKLMTNLSEHSKYTVSESMKE-ELKVFYGGFASEEETLKCIKETFDT----YQYL 396 Query: 419 LDPHTAVGVCATERLIAKDNDKSIQYISLSTAHPAKFADAVNNALSGFSNYSFEKDV-LP 477 +D HT+V + + +D + I +STA P KF +V +AL + YS+++D+ L Sbjct: 397 MDTHTSVAYSVYKNYL-RDTCDDTKTIVVSTASPFKFTKSVMSALD--TKYSYQEDLELV 453 Query: 478 EELKKLSTLKKKLKFIERADVELVKNAI------EEELAKMKL 514 E + K+++L+ + D ++V N + +EE+ K L Sbjct: 454 EVMSKIASLEIPAPIRKLEDSKVVHNTVCKREEMKEEIRKFLL 496 Lambda K H 0.316 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 635 Number of extensions: 38 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 514 Length of database: 496 Length adjustment: 34 Effective length of query: 480 Effective length of database: 462 Effective search space: 221760 Effective search space used: 221760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
Align candidate WP_011989272.1 CKL_RS03460 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.27416.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-79 252.2 0.6 4.9e-79 251.9 0.6 1.1 1 lcl|NCBI__GCF_000016505.1:WP_011989272.1 CKL_RS03460 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016505.1:WP_011989272.1 CKL_RS03460 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 251.9 0.6 4.9e-79 4.9e-79 24 332 .. 84 441 .. 64 449 .. 0.89 Alignments for each domain: == domain 1 score: 251.9 bits; conditional E-value: 4.9e-79 TIGR00260 24 elfrspkla..eevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelgne....tvlcAtsGdtga 86 + f+s+k+ e+vg ++ +elfhgPtlaFKD++l + l++ a+++++ ++l+AtsGdtg lcl|NCBI__GCF_000016505.1:WP_011989272.1 84 NKFESDKIVplEKVGD--VFYLELFHGPTLAFKDMALCLLPHLMKTAAKKQKLhkeiVILTATSGDTGK 150 5688888876677776..*******************99999998887766556788************ PP TIGR00260 87 aaaealagkanvkvvvLyPkgkispv.keklvtalaenakvlaikGdFDdaqdlvkeifedke...... 148 aa+e++a ++ k+vv+ P+ ++s + k+++vt+ +n kv++i+G+FDdaq vk+if+d+e lcl|NCBI__GCF_000016505.1:WP_011989272.1 151 AALEGFANVEGTKIVVFFPEQGVSKIqKKQMVTQQGGNTKVVGIEGNFDDAQSEVKKIFNDHElkeeln 219 ************************************************************777788999 PP TIGR00260 149 ..klklnsvNsinparieaqk.tyafeiveqlgk...espdkvvvpvpsgnfgailkGflekkelglpi 211 + ++s+Nsin++r+ q+ +y+++ +e l + + +k+ ++vp gnfg+il+++++kk++ lpi lcl|NCBI__GCF_000016505.1:WP_011989272.1 220 enSYRFSSANSINIGRLIPQVvYYFYGYMELLRRgeiNFGNKINFSVPTGNFGNILAAYYAKKMG-LPI 287 99******************************99888999************************9.*** PP TIGR00260 212 eklaiaaegaadivrrflksg.dlepkedkeTlstAmdignpsnverale.larrslgnledlke.... 274 +kl a++++ ++ f ++g ++ ++e T+s++mdi+++sn er+ + + +++l + lcl|NCBI__GCF_000016505.1:WP_011989272.1 288 NKLICASNEN-RVLYDFFENGtYDAEREFILTISPSMDILISSNLERLIYdISGKDSTVVNKLMTnlse 355 *********9.9999999999677777777*****************9986655555555555446777 PP TIGR00260 275 ....................svsdeeileaikklaeeegyllephtavavaalkklvekg...vs.... 316 +s+ee+l+ ik+ + +yl+++ht va+ + k+ + ++ + lcl|NCBI__GCF_000016505.1:WP_011989272.1 356 hskytvsesmkeelkvfyggFASEEETLKCIKETFDTYQYLMDTHTSVAYSVYKNYLRDTcddTKtivv 424 *******************999******************************99998888766224567 PP TIGR00260 317 atadpaKFeevve.alt 332 +ta+p KF ++v+ al lcl|NCBI__GCF_000016505.1:WP_011989272.1 425 STASPFKFTKSVMsALD 441 ************96665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (496 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.32 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory