Align pyrroline-5-carboxylate reductase (EC 1.5.1.2) (characterized)
to candidate WP_012041982.1 BBTA_RS08100 pyrroline-5-carboxylate reductase
Query= reanno::Caulo:CCNA_00528 (260 letters) >NCBI__GCF_000015165.1:WP_012041982.1 Length = 273 Score = 190 bits (483), Expect = 2e-53 Identities = 123/263 (46%), Positives = 157/263 (59%), Gaps = 11/263 (4%) Query: 3 PILLLGAGRMGGALIQGWQAAGAFDAADLIIRDP----HVDAAAFAGAVVNPPLETLGAA 58 PI+L GAG+MGGA++ GW AG D A +++ +P + A A G +NP T A Sbjct: 13 PIVLAGAGKMGGAMLTGW-LAGGLDPARVVVIEPMPSAEITALAARGIRLNPAAPT--PA 69 Query: 59 KTVLLAVKPQIWREAIADVVPHLAPDAVIVSIAAGVRAADISQAFGGRRVARVMPTTAVA 118 + V++AVKPQ++REA + P +A +++SI AG A + GG V R MP T A Sbjct: 70 EVVIVAVKPQMFREAGPALKPWVADTTLVLSIMAGTTIASLQNVVGGA-VVRAMPNTPAA 128 Query: 119 IGQG-AASLYADDAEALARAR--ALFAPLAAVAELASEDLMHAATAVSGSAPAYLYAFIE 175 IG+G ++ A D A RA AL AV + E LM A TAVSGS PAY++ E Sbjct: 129 IGRGITVAVPASDVSAAQRALTDALLRATGAVEWVDDEALMDAVTAVSGSGPAYVFLLAE 188 Query: 176 ALEAAGAAQGLDPAQSARLARATIIGAAALMAQSGEEPAELRKQVTSPGGTTAAALSVLM 235 L AG A GL A + RLAR T+ GA L+ +S A LR+ VTSPGGTTAAALSVLM Sbjct: 189 ELARAGIAAGLPEALATRLARDTVSGAGELLHRSELSSATLRQNVTSPGGTTAAALSVLM 248 Query: 236 GAGGFGDLLPKALDAAVARSKEL 258 G GF LL +A+ AA ARSKEL Sbjct: 249 GPDGFQPLLERAVAAATARSKEL 271 Lambda K H 0.318 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 273 Length adjustment: 25 Effective length of query: 235 Effective length of database: 248 Effective search space: 58280 Effective search space used: 58280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_012041982.1 BBTA_RS08100 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00112.hmm # target sequence database: /tmp/gapView.20980.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-76 242.0 6.1 4.7e-76 241.9 6.1 1.0 1 lcl|NCBI__GCF_000015165.1:WP_012041982.1 BBTA_RS08100 pyrroline-5-carboxy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015165.1:WP_012041982.1 BBTA_RS08100 pyrroline-5-carboxylate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 241.9 6.1 4.7e-76 4.7e-76 1 263 [] 14 271 .. 14 271 .. 0.93 Alignments for each domain: == domain 1 score: 241.9 bits; conditional E-value: 4.7e-76 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKP 69 i++ GaG+mg a+l+g+l+ g ++++++vie+++++ +++ g++ + + a + a+vv++avKP lcl|NCBI__GCF_000015165.1:WP_012041982.1 14 IVLAGAGKMGGAMLTGWLAGG-LDPARVVVIEPMPSAEITALAARGIRLNPA---APTPAEVVIVAVKP 78 6788***************75.569*********555555555556777766...568899******** PP TIGR00112 70 qdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevse 138 q+++e+ lk + ++l++Si+AG+ti+ l++ +++ +vvR+mPNt+a++g+g+t+++ s+vs+ lcl|NCBI__GCF_000015165.1:WP_012041982.1 79 QMFREAGPALKP-WVADTTLVLSIMAGTTIASLQNVVGG--AVVRAMPNTPAAIGRGITVAVPASDVSA 144 ***********9.666899******************87..8*************************** PP TIGR00112 139 eqkelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlk 206 +q++l ++ll+a+G v +v+ e+l+davta+sGSgPA+vfll+e la+ag+++GLp+++a++la++t+ lcl|NCBI__GCF_000015165.1:WP_012041982.1 145 AQRALTDALLRATGAVEWVDdEALMDAVTAVSGSGPAYVFLLAEELARAGIAAGLPEALATRLARDTVS 213 ********************************************************************* PP TIGR00112 207 GaaklleesgehpalLkdkVtsPgGtTiaglavLeekg.vrsavieaveaavkrseeL 263 Ga++ll++s+ + a+L+++VtsPgGtT+a+l+vL+ + ++ +++av aa++rs+eL lcl|NCBI__GCF_000015165.1:WP_012041982.1 214 GAGELLHRSELSSATLRQNVTSPGGTTAAALSVLMGPDgFQPLLERAVAAATARSKEL 271 *********99**********************997544*****************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (273 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.55 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory