Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate WP_012042290.1 BBTA_RS09650 phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_000015165.1:WP_012042290.1 Length = 415 Score = 404 bits (1038), Expect = e-117 Identities = 203/407 (49%), Positives = 280/407 (68%), Gaps = 3/407 (0%) Query: 227 SYPKSRINVLLLENVHPIGVEIMKQEGYN-VEVVSSAMSEEELCEKIKNVSIIGIRSKTQ 285 S PK +I VLLLE V+ V + + GY +E + A+ EL + V ++GIRS+T Sbjct: 4 SLPKQKIRVLLLEGVNDSAVRMFEANGYTEIERLPKALGSAELKRMLSGVHMLGIRSRTH 63 Query: 286 ITKKVLENANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLM 345 +T+ VL+ A+RLM VG F +GTNQ+DL+ + GI VFNAP+SNTRSV EL I+E++ LM Sbjct: 64 LTEDVLQAADRLMVVGCFSVGTNQVDLDAAKRLGIPVFNAPYSNTRSVAELTIAEVVMLM 123 Query: 346 RNLHDKTLKMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYDIVE 405 R + +++ H G W+KSA+GS EVRGK LGI+GYGNIG+QLS LAE MGM V ++D+ + Sbjct: 124 RRIFPRSVAAHAGGWDKSANGSREVRGKTLGIVGYGNIGSQLSNLAEAMGMRVIFFDLTD 183 Query: 406 RLALGNATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVV 465 +L GN ++SLDELL D++SLHV N++ + +I MK GA L+N SRG VV Sbjct: 184 KLRHGNTEPVESLDELLAMSDVVSLHVPETPATANMIGERQIRHMKDGAYLINNSRGTVV 243 Query: 466 DVPALRDALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENI 525 D+ AL AL G LAGAAVDVFP EP +N +PF S L G PN ILTPH+GGST EAQ+ I Sbjct: 244 DIEALASALRDGKLAGAAVDVFPVEPASNADPFVSPLQGLPNVILTPHVGGSTEEAQDRI 303 Query: 526 AQFVPGKIIEYINSGNTFNSVNFPNIQLPFLKDAHRLIHIHQNAPGVLAKINQVLASYKI 585 V K+I+Y + G+TF +VNFP +QLP R IH+H+N PGVL ++N+ ++ + I Sbjct: 304 GGEVARKLIDYSDVGSTFGAVNFPQVQLPARPTGTRFIHVHRNVPGVLRQVNEAVSRHNI 363 Query: 586 NIVGQYLKTNEKIGYVI--TDIDKRYSNDVIDALKEIEGTIRFRILY 630 NI+ QYL+T+ ++GYV+ TD+ +++ L+ +EGTIR R+LY Sbjct: 364 NILAQYLQTDPEVGYVVLETDVVGGEGEELLSELRAVEGTIRVRVLY 410 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 578 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 630 Length of database: 415 Length adjustment: 35 Effective length of query: 595 Effective length of database: 380 Effective search space: 226100 Effective search space used: 226100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory