Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate WP_012048893.1 SWIT_RS13595 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= CharProtDB::CH_000559 (406 letters) >NCBI__GCF_000016765.1:WP_012048893.1 Length = 407 Score = 283 bits (723), Expect = 8e-81 Identities = 175/397 (44%), Positives = 227/397 (57%), Gaps = 6/397 (1%) Query: 13 LPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAPVHIAKSHLFDED 72 LP I G + A+AG K+ DLT A G+ V V TT+R + V ++ L Sbjct: 14 LPPIAGARVAVARAGYKRWDRADLTYAAFDEGTVVAGVTTTSRCPSPEVEWCRAAL-PLG 72 Query: 73 GVRALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTGVILEPLPADKI- 131 RALV+N GN+NA TG +GR A+ A A IGC+P+ V STGVI PLP DK Sbjct: 73 QARALVVNAGNSNAFTGNRGRAAVEAITARVAGAIGCRPSDVFVASTGVIGVPLPIDKAE 132 Query: 132 --IAALPKMQPAFWNEAARAIMTTDTVPKAASREGKVGDQHTVRATGIAKGSGMIHPNMA 189 I A+ + A W EAA IMTTDT KAA VG V GI KGSGMI P+MA Sbjct: 133 AGIDAVLRAPEASWEEAAATIMTTDTFAKAARASAMVGGAR-VELVGIVKGSGMIAPDMA 191 Query: 190 TMLGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVIIATGKNSQSEIDNI 249 TMLGF+ TDA ++ +LQ M +F+ ITVDGDTST+D+ + ATGK + ++ + Sbjct: 192 TMLGFVFTDAAIAPELLQAMLNRANARSFSCITVDGDTSTSDTVLAFATGKAGHARLETM 251 Query: 250 ADPRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEARQAAYAAARSPLV 309 DP L+ L ++ LELAQ +VRDGEGA+KFI V VE A++ A + A + A SPLV Sbjct: 252 DDPGADALEAALNAVCLELAQLVVRDGEGASKFIAVTVEGAESDASAHRIALSIANSPLV 311 Query: 310 KTAFFASDPNLGKRLAAIGYADVADLDTDLVEMYLDDILVAEHGGRAASYTEAQGQAVMS 369 KTA D N G+ + A+G A + D + + VA G Y EA A + Sbjct: 312 KTAIAGEDANWGRVVMAVGKAG-EPAERDRLSIRFGATQVATGGLAVEGYDEAPVAAHLK 370 Query: 370 KDEITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 EI + + + G ATV+TCDL+HGY+SINADYRS Sbjct: 371 GREIEIGVDIGLGNGRATVWTCDLTHGYISINADYRS 407 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 407 Length adjustment: 31 Effective length of query: 375 Effective length of database: 376 Effective search space: 141000 Effective search space used: 141000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory