Align aromatic-amino-acid transaminase [EC:2.6.1.57] (characterized)
to candidate WP_012050370.1 SWIT_RS21210 aspartate/tyrosine/aromatic aminotransferase
Query= reanno::Phaeo:GFF2895 (394 letters) >NCBI__GCF_000016765.1:WP_012050370.1 Length = 396 Score = 327 bits (838), Expect = 4e-94 Identities = 172/391 (43%), Positives = 237/391 (60%), Gaps = 10/391 (2%) Query: 2 FETLKPQPADKILALMQMYRDDPRDSKIDLGVGVYKNAEGVTPVMRAIKAAEHKLWEEQT 61 F TL+PQPAD +L+L++++R+D R KIDLGVGVY+N +G TPV RA+KAAE KL E Q Sbjct: 9 FATLQPQPADPLLSLIKLFREDGRAGKIDLGVGVYRNDKGETPVFRAVKAAERKLVETQA 68 Query: 62 SKSYVGLAGDPAYSDAMIKLILSDSVARANVAAAATPGGTGAVRQAFELIKMANPGARVF 121 +K+Y+G G+ AY D + L+ + A +++ TPGGTGA+R E+ A PG R++ Sbjct: 69 TKAYLGADGNVAYLDRLRALLFAQP-APSDLVGLQTPGGTGAIRLGMEIANAARPGTRIW 127 Query: 122 VSNPTWPNHISILNYLNIETVAYRYFDRETCGVDFDGMIADLKT-ANKGDVVLLHGCCHN 180 +S+P+WP HI + +E +RY D T V FD ++ L+ A GDV+LL GCCHN Sbjct: 128 ISDPSWPAHIPLARIAGLEPATFRYLDPATGLVAFDEVMDLLRNRAEPGDVILLQGCCHN 187 Query: 181 PTGANLNMVQWQEVVAILNERGLIPMIDIAYQGFGDGLEEDAQGVRYVAANTPECLIAAS 240 PTGA+L QW E A + ERGLIP +D AY G G G+EED GVR + A+ P+ +A S Sbjct: 188 PTGADLTPAQWTEAAAAMRERGLIPFVDFAYHGLGTGIEEDLAGVR-IIADLPQYFLAYS 246 Query: 241 CSKNFGIYRERTGLLMAVSQDSGAQALNQGTLAFLNRQNYSFPPDHGARLVSMILNDDAL 300 CSKNFG+YRER G L + +G+ LA +R +S PPDHGA +V IL+D L Sbjct: 247 CSKNFGLYRERVGALFVRTGSTGSNLAVMSNLALRSRLLWSMPPDHGAAIVEAILSDAGL 306 Query: 301 RADWAAELEETRLGMLALRQQLADELQRLTGSDRFGFLAQHRGMFSLLGTTPEMVEKMRA 360 W AEL E R + +R ++ G LA +GMF+ L PE V+ +R Sbjct: 307 TGQWQAELAEMRARIRGVRALFG----KVPG---LAVLAGQQGMFAQLALQPEQVQMLRT 359 Query: 361 ESGIYMVGDSRMNIAGLNTQTVPILAQAIVD 391 E IYM R+N+AG++ + A+ D Sbjct: 360 EQAIYMAESGRINLAGISLEEAARFIAALGD 390 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 396 Length adjustment: 31 Effective length of query: 363 Effective length of database: 365 Effective search space: 132495 Effective search space used: 132495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory