Align Methionine synthase component, methyltransferase domain (EC:2.1.1.13) (characterized)
to candidate WP_012101348.1 CKL_RS04800 homocysteine methyltransferase
Query= reanno::Phaeo:GFF1321 (338 letters) >NCBI__GCF_000016505.1:WP_012101348.1 Length = 801 Score = 146 bits (368), Expect = 2e-39 Identities = 92/278 (33%), Positives = 151/278 (54%), Gaps = 10/278 (3%) Query: 18 DGATGTNLFNMGLQSGDAPELWNVDEPKKITALYQGAVDAGSDLFLTNTFGGTAARLKLH 77 DGA GT L GL+ G+ PE+ N+ P+ I+ +++ +DAG+D+ TNTFG A LK Sbjct: 18 DGAMGTMLQKAGLKLGELPEVLNITNPEIISGIHRKYLDAGADIITTNTFG--ANELKYD 75 Query: 78 DAHRRVRELNVAGAELGRNVADRSERKIAVAGSVGPTGEIMQPVGELSHALAVEMFHEQA 137 + + ++ AG +L + A VA +GP G+IM+P G LS A ++F Q Sbjct: 76 SSDYTIEDVISAGVKLAKQEAGDK----LVALDIGPIGKIMEPTGNLSFESAYKLFKNQI 131 Query: 138 EALKEGGVDVLWLETISAPEEYRAAAEAFK-LADMPWCGTMSFDTAGRTMMGVTSADMAQ 196 ++ G DV+ +ET++ E +AA A K +++P TM+F GRT+MG + M Sbjct: 132 VIGEKSGADVVLIETMTDLYEAKAAVLAAKENSNIPIFCTMTFQEDGRTLMGTDAKTMVF 191 Query: 197 LVEEFDPAPLAFGANCGTGASDILRTVLGFAAQGTTRPIISKGNAGIPKYVDGHIHYDGT 256 ++E L G NC G + L+ ++ + ++ P++ + NAG+P+Y + YD + Sbjct: 192 VLEALGVDVL--GVNCSLGPKE-LQGIVEEILKYSSIPVMVQPNAGLPRYDGENTIYDIS 248 Query: 257 PTLMGEYAAMARDCGAKIIGGCCGTMPDHLRAMREALD 294 P E G +++GGCCGT P+ +R R+ L+ Sbjct: 249 PEDFAENVLTMAQKGIRVLGGCCGTTPEFIRMCRKDLE 286 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 604 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 801 Length adjustment: 35 Effective length of query: 303 Effective length of database: 766 Effective search space: 232098 Effective search space used: 232098 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory