Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate WP_012101666.1 CKL_RS06295 tryptophan synthase subunit beta
Query= uniprot:P50383 (425 letters) >NCBI__GCF_000016505.1:WP_012101666.1 Length = 396 Score = 137 bits (346), Expect = 4e-37 Identities = 114/357 (31%), Positives = 174/357 (48%), Gaps = 32/357 (8%) Query: 73 GRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTETG 132 GRPTPL+ A+ L + L A+IY K E TG+HKIN + Q AK G + V+ ETG Sbjct: 56 GRPTPLYYAENLTKNLGG-AKIYLKREDLNHTGAHKINNVLGQILLAKRMGKKKVIAETG 114 Query: 133 AGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEYGRKIL 192 AGQ G AVA A+M+ M+ I+M + ++ + M++ GA V + E G K L Sbjct: 115 AGQHGVAVATGAAMFQMECVIYMGEEDCRRQSLNVLRMKILGAKVVS-----VESGTKTL 169 Query: 193 ETNPQHPGSLGIAMSEAIEYALKN--EFRYLVGSVL------DVVLLHQSVIGQETITQ- 243 + A++EA+ ++N + Y++GSV+ +V Q +IG ET Q Sbjct: 170 KD----------AVNEALRKWVENIEDTFYVMGSVVGPHPYPTMVRDFQRIIGDETKEQI 219 Query: 244 LDLLGEDADILIGCVGGGSNFGGFTYPFIGNKKGKRYIAVSSAEIPKFSKGEYKYDFPDS 303 L G+ + +I CVGGGSN G YPF+ +K K I V +A + + S Sbjct: 220 LKKEGKLPNYIIACVGGGSNSMGIFYPFVEDKSVK-LIGVEAAGLGVDTDKHAASMAKGS 278 Query: 304 AGLLPLVKMITLGKD---YVPPPIYAGGLRYHGVAPTLSLLTKEGIVEWREYNEREIFEA 360 G+L + + D +P + GL Y GV P + L E+ ++E +A Sbjct: 279 VGVLHGMMTYLIQDDEGQILPVYSVSAGLDYPGVGPEHAYLKDTKRAEYTYVTDQEALDA 338 Query: 361 AKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGLLDLSNYESM 417 +GI+PA ES+HA+ + A E K +++V N+SG G D+ + Sbjct: 339 FGYLSRCEGIIPALESSHALAYTMKLAPELSK---EEIVVVNISGRGDKDVDTISEL 392 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 396 Length adjustment: 31 Effective length of query: 394 Effective length of database: 365 Effective search space: 143810 Effective search space used: 143810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012101666.1 CKL_RS06295 (tryptophan synthase subunit beta)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.16661.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-204 663.6 0.7 5.6e-204 663.4 0.7 1.0 1 lcl|NCBI__GCF_000016505.1:WP_012101666.1 CKL_RS06295 tryptophan synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016505.1:WP_012101666.1 CKL_RS06295 tryptophan synthase subunit beta # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 663.4 0.7 5.6e-204 5.6e-204 1 383 [. 9 391 .. 9 393 .. 1.00 Alignments for each domain: == domain 1 score: 663.4 bits; conditional E-value: 5.6e-204 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiy 69 g+fg+fGGqyvpe++++al ele+ ++kak+d++f +e++++l+ey+grptpl++a+nl+k+lggakiy lcl|NCBI__GCF_000016505.1:WP_012101666.1 9 GRFGRFGGQYVPETVMTALMELEESFNKAKEDSKFIDEYMYYLQEYSGRPTPLYYAENLTKNLGGAKIY 77 78******************************************************************* PP TIGR00263 70 lkredllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqk 138 lkredl+htGahkinn+lgq+llakr+Gkk++iaetGaGqhGva at aa++++ec++ymG+ed rq+ lcl|NCBI__GCF_000016505.1:WP_012101666.1 78 LKREDLNHTGAHKINNVLGQILLAKRMGKKKVIAETGAGQHGVAVATGAAMFQMECVIYMGEEDCRRQS 146 ********************************************************************* PP TIGR00263 139 lnvfrmellgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeev 207 lnv rm++lgakvv+v+sG+ktlkdavnealr+Wv ++edt+yv+Gs+vGphP+P++vr+fq++ig+e+ lcl|NCBI__GCF_000016505.1:WP_012101666.1 147 LNVLRMKILGAKVVSVESGTKTLKDAVNEALRKWVENIEDTFYVMGSVVGPHPYPTMVRDFQRIIGDET 215 ********************************************************************* PP TIGR00263 208 keqilekegrlPdaviacvGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhG 276 keqil+keg+lP+++iacvGGGsn++Gif++f+ed++v+ligvea+G+G+dt+khaa+++kG++GvlhG lcl|NCBI__GCF_000016505.1:WP_012101666.1 216 KEQILKKEGKLPNYIIACVGGGSNSMGIFYPFVEDKSVKLIGVEAAGLGVDTDKHAASMAKGSVGVLHG 284 ********************************************************************* PP TIGR00263 277 aktkllqdedGqieeahsvsaGldypgvgPehaalaetgraeyeaitdeealealkllskeeGiipale 345 ++t+l+qd++Gqi +++svsaGldypgvgPeha+l++t+raey+ +td+eal+a+ +ls++eGiipale lcl|NCBI__GCF_000016505.1:WP_012101666.1 285 MMTYLIQDDEGQILPVYSVSAGLDYPGVGPEHAYLKDTKRAEYTYVTDQEALDAFGYLSRCEGIIPALE 353 ********************************************************************* PP TIGR00263 346 sshalaaleklapklkkdeivvvnlsGrGdkdletvak 383 sshala+ +klap+l+k+eivvvn+sGrGdkd++t+ + lcl|NCBI__GCF_000016505.1:WP_012101666.1 354 SSHALAYTMKLAPELSKEEIVVVNISGRGDKDVDTISE 391 ***********************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (396 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.72 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory