Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_012101682.1 CKL_RS06375 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000016505.1:WP_012101682.1 Length = 435 Score = 285 bits (730), Expect = 3e-81 Identities = 163/435 (37%), Positives = 260/435 (59%), Gaps = 14/435 (3%) Query: 359 LDVVKASDKVGVQ---KALSRPIQKTSEIMHLVNPIIENVRDKGNSALLEYTEKFDGVKL 415 + ++KA+ + G + ++ + + ++ VN I+E V+ KG+++L++YT +FD + Sbjct: 6 ISIIKANTQKGKEYFNDLRNKEEEAHNNVILEVNEILEQVKKKGDTSLIKYTNRFDSCNV 65 Query: 416 S--NPVLNAPFPEEYFEGLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRF 473 + N ++ E+ + + +E EAL + EN+ FH Q + + G++ + Sbjct: 66 TKENMLVTQSETEDAYRLVEDEFIEALKTASENIMFFHQKQKRNSWITTR-EDGIMLGQQ 124 Query: 474 PRPIEKVGLYIPGGTAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEK 533 RP+E+VG+Y+PGG A PS+ LM +PA+VA +EI+ +PP K DG ++P ++ A+ Sbjct: 125 IRPLERVGIYVPGGRAAYPSSVLMNTIPAKVAGVEEIIMVTPPMK-DGTINPNILVAADI 183 Query: 534 VGASKIVLAGGAQAVAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPA 593 G KI GGAQAV A+A+GTE+I KVDKI+GPGN FV AK V IDM A Sbjct: 184 AGVDKIYKVGGAQAVGALAFGTESINKVDKIVGPGNVFVAMAKKSVYG----YVDIDMIA 239 Query: 594 GPSEVLVIADEDADVDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQL 653 GPSE+L+IADE A ++A+DL+SQAEH + + IL+ S+ +E++ + Q L Sbjct: 240 GPSEILIIADEGAKASYLAADLMSQAEHDLMASSILI--TTSKDLAKEVKKELEKQIEHL 297 Query: 654 PRVDIVRKCIA-HSTIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVG 712 R DI+RK + H I+L + E+AL++SN+ APEHL + I + + + NAGS+F+G Sbjct: 298 ERKDIIRKSLKDHGVIMLVESIEQALDISNKIAPEHLEVCIRDPFMVLGDIKNAGSIFLG 357 Query: 713 AYTPESCGDYSSGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVA 772 ++PE GDY +G NH LPT G AR +S + F K + + + L IG ++ +A Sbjct: 358 DFSPEPLGDYMAGPNHVLPTSGTARFFSPLSVDDFIKKSSFTHYSERALSKIGDKIVKLA 417 Query: 773 KKEGLDGHRNAVKIR 787 + EGL H N++ +R Sbjct: 418 QGEGLTAHANSIMVR 432 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 757 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 435 Length adjustment: 37 Effective length of query: 762 Effective length of database: 398 Effective search space: 303276 Effective search space used: 303276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory