Align IGP synthase, amidotransferase subunit (EC 4.3.2.10) (characterized)
to candidate WP_012101685.1 CKL_RS06390 imidazole glycerol phosphate synthase subunit HisH
Query= reanno::Miya:8501586 (212 letters) >NCBI__GCF_000016505.1:WP_012101685.1 Length = 202 Score = 147 bits (372), Expect = 1e-40 Identities = 83/205 (40%), Positives = 119/205 (58%), Gaps = 12/205 (5%) Query: 1 MLAILDYKAGNQTSVRRALDHLGIPCVITADPAVIAGAHGVIFPGVGAAGQAMNELLTTG 60 M++I+DY GN SV++AL ++G IT+D I + GVI PGVGA +AM L + Sbjct: 1 MISIIDYGMGNLKSVKKALKYIGEEAQITSDKDYIENSQGVILPGVGAFPEAMKNLRSKK 60 Query: 61 LDKVLKDQVQAGKPLLGICVGCQIMLDYSQE-NDTKALGIVPGE-CRLFNAAWTEEDGTP 118 LD +K+ V+ PLLGIC+G Q++ D +E + K LG++PG +L+ Sbjct: 61 LDVAIKNAVEKRIPLLGICLGMQLLFDTGEEIKNCKGLGLIPGNIAKLYG---------N 111 Query: 119 IRVPHMGWNSIVQKRPCELLKGIEPEAEFYFVHSYY-PAPPESYVIATCTYGEEFCAIHG 177 I++PHMGWNS+ K+ C LL+ I + YFVHS+Y E + A YG E A+ Sbjct: 112 IKIPHMGWNSLNLKKKCALLESIPENSYVYFVHSFYADMKYEENLNACSVYGIEVPAVVS 171 Query: 178 GPGLWAVQFHPEKSGRPGLALLRNF 202 ++ QFHPEKSG G+ +L NF Sbjct: 172 NGKVYGTQFHPEKSGDVGIKILENF 196 Lambda K H 0.321 0.139 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 202 Length adjustment: 21 Effective length of query: 191 Effective length of database: 181 Effective search space: 34571 Effective search space used: 34571 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate WP_012101685.1 CKL_RS06390 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01855.hmm # target sequence database: /tmp/gapView.21111.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01855 [M=198] Accession: TIGR01855 Description: IMP_synth_hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-79 250.0 0.1 9.4e-79 249.9 0.1 1.0 1 lcl|NCBI__GCF_000016505.1:WP_012101685.1 CKL_RS06390 imidazole glycerol p Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016505.1:WP_012101685.1 CKL_RS06390 imidazole glycerol phosphate synthase subunit HisH # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 249.9 0.1 9.4e-79 9.4e-79 1 197 [. 2 198 .. 2 199 .. 0.99 Alignments for each domain: == domain 1 score: 249.9 bits; conditional E-value: 9.4e-79 TIGR01855 1 ivvidygvgNlksvkkalervgaesevvkdskelekadklvlPGVGafkeamkklrelelellaekvvk 69 i +idyg+gNlksvkkal+ +g e+++++d++ +e+++ ++lPGVGaf eamk+lr ++l++ ++++v+ lcl|NCBI__GCF_000016505.1:WP_012101685.1 2 ISIIDYGMGNLKSVKKALKYIGEEAQITSDKDYIENSQGVILPGVGAFPEAMKNLRSKKLDVAIKNAVE 70 68******************************************************************* PP TIGR01855 70 kkkpvlgiClGmQllfekseEgkevkglglikgkvkkleaekkvPhiGWnevevvkesellkgleeear 138 k+ p+lgiClGmQllf+++eE k++kglgli+g++ kl + k+Ph+GWn+++ +k+++ll+ + e+++ lcl|NCBI__GCF_000016505.1:WP_012101685.1 71 KRIPLLGICLGMQLLFDTGEEIKNCKGLGLIPGNIAKLYGNIKIPHMGWNSLNLKKKCALLESIPENSY 139 ********************************************************************* PP TIGR01855 139 vYfvHsYaveleeeeavlakadygekfvaavekdnivgvQFHPEkSgktGlkllknfle 197 vYfvHs+++ ++ ee++ a + yg + +a+v++++++g+QFHPEkSg++G k+l+nf+ lcl|NCBI__GCF_000016505.1:WP_012101685.1 140 VYFVHSFYADMKYEENLNACSVYGIEVPAVVSNGKVYGTQFHPEKSGDVGIKILENFAT 198 ********************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (198 nodes) Target sequences: 1 (202 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.73 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory