Align 3-phosphoglycerate dehydrogenase (characterized, see rationale)
to candidate WP_012104129.1 CKL_RS18585 D-2-hydroxyacid dehydrogenase
Query= uniprot:A0A1X9ZCD3 (315 letters) >NCBI__GCF_000016505.1:WP_012104129.1 Length = 310 Score = 246 bits (627), Expect = 7e-70 Identities = 141/318 (44%), Positives = 201/318 (63%), Gaps = 23/318 (7%) Query: 1 MKILANDGIDPIGKELLEKAGFQVDTETVPQDQLAEALKNYDAITVRSATKVRKELIDAV 60 +KIL +DG+D L + G++V + +++L +K +D I VRSATK+RK LIDA Sbjct: 2 IKILVSDGMDKEALNKLVEDGYEVIDKHFDEEELKNKIKEFDVIIVRSATKIRKPLIDAA 61 Query: 61 PN--IKLIGRGGVGMDNIDVEYARSQGINVVNTPAASSLSVAELVFSHLFTGIRFLQDAN 118 + +KLI RGGVG+DNIDV+YA GI V NTP AS+ SVAEL +H+F R++ +N Sbjct: 62 KDGKLKLIIRGGVGVDNIDVDYALQNGIVVKNTPNASAASVAELTLAHMFAISRYVNISN 121 Query: 119 RKMPVEGSTQFNNLKKAYAKGTELSGKTIGIIGFGRIGRATAKVALGLGMNVLAYD-LYP 177 M + N K+ KG EL GKT+GI+GFGRI + AK A LGM ++ D L Sbjct: 122 VTM------RNNEWHKSQYKGVELYGKTLGIVGFGRIAKEVAKRANALGMKIIYTDKLGM 175 Query: 178 SESEITLEFQGGKSVSIPIKTVSLDEVITGSDFFSLHTPFA--DKPILGAEEFAKMKNGV 235 ++ EF +++ +D+ + H PF+ K ++G EEF MK+GV Sbjct: 176 AKGYNNYEF------------CEFKDLLKRADYITFHIPFSKDQKALIGEEEFNIMKDGV 223 Query: 236 GIVNCSRGGTIDELALIDALNSGKVSFAGLDVFDNEPTPLAEILTHPKISLTPHIGASTN 295 I+NC+RGG IDE ALI+AL+ GKV+ AG+DVF NEP+P E+L + ++S TPHIGAST Sbjct: 224 YIINCARGGIIDEKALINALDCGKVAGAGIDVFKNEPSPCEELLNNDRVSATPHIGASTC 283 Query: 296 EAQERIGTELATLIIEHF 313 EAQ+RIG E+ ++ +++ Sbjct: 284 EAQKRIGMEIVNIVEQYY 301 Lambda K H 0.316 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 310 Length adjustment: 27 Effective length of query: 288 Effective length of database: 283 Effective search space: 81504 Effective search space used: 81504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory