Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (uncharacterized)
to candidate WP_012113640.1 XAUT_RS08095 shikimate dehydrogenase
Query= curated2:Q2RI72 (295 letters) >NCBI__GCF_000017645.1:WP_012113640.1 Length = 277 Score = 157 bits (398), Expect = 2e-43 Identities = 107/258 (41%), Positives = 137/258 (53%), Gaps = 9/258 (3%) Query: 3 QVKASTGLVALLGHPVQHSLSPLMHNAAFAAGGQNLVYLAFDVKPGDLAAALAGLKAL-G 61 ++ T + +L P+ H +P M NA A G++ V + F V P DLA +AGLK + Sbjct: 9 EITGHTRVYGILADPIHHVKTPQMLNALMAREGRDGVMVPFQVAPDDLATLVAGLKTMKS 68 Query: 62 FRGANVTVPHKEAIIPYLDAVDPVAARIGAVNTIVNE-DRCLKGYNTDGSGFLRSLEEAG 120 G VTVPHK AI+ DAV A RIGAVNT+ E D L G DG GF+ L AG Sbjct: 69 LGGFVVTVPHKTAIVDLCDAVSDSARRIGAVNTVRREADGRLIGEMLDGKGFVGGLLAAG 128 Query: 121 FDPAGKRAVILGAGGAARAVAFALATAGCGSLVLANRTPERATELAGALAGAGLPAPVVY 180 DP K + GAGGAA A+AFA AG L +ANRT +A +LA LA A A V Sbjct: 129 IDPKDKSVYLAGAGGAANAIAFAFVEAGISRLTIANRTRAKAEDLAVRLAEAYPKAQV-- 186 Query: 181 RLGDAGMRSEVEAADLVLNTTSLGMWPRVEETPLPPDWFRPGQWVYDLVYNPLETKFLAG 240 D G + D+V+N TSLG+ + PL P Q V +++ P ET LA Sbjct: 187 ---DIG-NPDPSGHDIVVNGTSLGL-KDGDALPLDTARLSPEQIVAEVIMQPEETALLAA 241 Query: 241 ARRRGCRVISGLDMLLYQ 258 A+ +GCR+ G ML Q Sbjct: 242 AKAKGCRIHFGKPMLACQ 259 Lambda K H 0.320 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 277 Length adjustment: 26 Effective length of query: 269 Effective length of database: 251 Effective search space: 67519 Effective search space used: 67519 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory