Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate WP_012114603.1 XAUT_RS13000 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >NCBI__GCF_000017645.1:WP_012114603.1 Length = 397 Score = 301 bits (772), Expect = 2e-86 Identities = 164/375 (43%), Positives = 228/375 (60%), Gaps = 8/375 (2%) Query: 1 MQAAEILGKLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKE 60 + + EIL KL+ S+ PN +VV+ I + + V LP G+++ + +IGP++ Sbjct: 5 VSSEEILDKLISISSITDTPNEEVVAAIAA-IAAPFARVRRLPNAGGEKTALLISIGPED 63 Query: 61 ARGYIISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMP 120 G ++S H DVV WTS+PFR+ RLYGRGT+DMKGF+A VLAA+P AA Sbjct: 64 RPGIVLSAHTDVVAVEGQPWTSNPFRIAARDGRLYGRGTSDMKGFIACVLAALPAFAAAD 123 Query: 121 LRRPLHLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLT 180 P+H+ALSYDEE GC+G ++A + L +PL I+GEPT M+ RAHKGK R T Sbjct: 124 PLTPVHVALSYDEEIGCKGAGDLVAAVAALPARPLMCIVGEPTAMKVKRAHKGKTGWRAT 183 Query: 181 VRGRSGHSSRPDQGLNAIHGVAGVLTQAVAEADRLVGGPFEHVFEPPYSSLQIGTVKGGQ 240 GR+GHS+ P Q NA+ +A + + AD L G + F+PPY++L IG++ GG Sbjct: 184 ALGRTGHSALPHQAANAVTALARLAARLADLADELKTGAQDRAFDPPYATLHIGSLHGGG 243 Query: 241 AVNIIPDSCEVEFEARAISGVDPAELL----APVRKTAEALTTLGFEVE--WQELSAYPA 294 A+N++PD +EFE R I G D L A V++ L E + +ELSAYPA Sbjct: 244 ALNVVPDRAVMEFELRTIPGSDTNTLFRRIEALVQEARAVLKAQAPEADLLLEELSAYPA 303 Query: 295 LSLEPDAPLAALLEELTGREALP-AVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYI 353 L+ DAP AA + LTG +P +++GTEAGL+ +AGI ++CGPGDI RAHK DE+I Sbjct: 304 LATASDAPEAAAVARLTGDNGVPGTIAFGTEAGLYAQAGIPTLVCGPGDIARAHKADEWI 363 Query: 354 LIDELMACRAMVEAL 368 +EL C AM+ L Sbjct: 364 GREELAQCDAMLARL 378 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 397 Length adjustment: 30 Effective length of query: 344 Effective length of database: 367 Effective search space: 126248 Effective search space used: 126248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012114603.1 XAUT_RS13000 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.931287.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-115 371.9 1.4 2e-115 371.7 1.4 1.0 1 NCBI__GCF_000017645.1:WP_012114603.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000017645.1:WP_012114603.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 371.7 1.4 2e-115 2e-115 1 364 [. 9 378 .. 9 379 .. 0.96 Alignments for each domain: == domain 1 score: 371.7 bits; conditional E-value: 2e-115 TIGR01892 1 eilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDvvPv 73 eil kL+++ s++ ++n +++ +++ ++ v++lp+a+g ek+ ll +iGp++ + g+vls htDvv v NCBI__GCF_000017645.1:WP_012114603.1 9 EILDKLISISSITDTPNEEVVAAIAAI-AAPFARVRRLPNAGG-EKTALLISIGPED-RPGIVLSAHTDVVAV 78 79********************99875.556679*********.***********99.*************** PP TIGR01892 74 deaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakklieala 146 ++++Wts+pfr+ +dgrLYgrGt+DmkGF+a+vLaa+p aaa+ P+h++ls+Dee+g++Ga +l++a+a NCBI__GCF_000017645.1:WP_012114603.1 79 EGQPWTSNPFRIAARDGRLYGRGTSDMKGFIACVLAALPAFAAADPLTPVHVALSYDEEIGCKGAGDLVAAVA 151 *********************************************************************9998 PP TIGR01892 147 ...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvaladklkredle 216 rp + ivGePt ++ RahkGk + t Gr ghs+ p++ ++a++ +a+l arl +lad+lk + ++ NCBI__GCF_000017645.1:WP_012114603.1 152 alpARPLMCIVGEPTAMKVKRAHKGKTGWRATALGRTGHSALPHQAANAVTALARLAARLADLADELKTGAQD 224 8889********************************************************************* PP TIGR01892 217 eaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee....vkekapgfevkvee 285 aF+ppyatl+iG ++GG a n++++ ++++elR+ipG d + l +e++ +e +k++ap+ + ee NCBI__GCF_000017645.1:WP_012114603.1 225 RAFDPPYATLHIGSLHGGGALNVVPDRAVMEFELRTIPGSDTNTLFRRIEALVQEaravLKAQAPEADLLLEE 297 ******************************************99887777766666665999*********** PP TIGR01892 286 lsatpaleleedaelvalleklaGa..aaevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkr 356 lsa+pal++ da+ +a +++l+G+ + ++++gteagl ++Gi+++v+GPGdi +ah++de++ eel + NCBI__GCF_000017645.1:WP_012114603.1 298 LSAYPALATASDAPEAAAVARLTGDngVPGTIAFGTEAGLYAQAGIPTLVCGPGDIARAHKADEWIGREELAQ 370 *************************88899******************************************* PP TIGR01892 357 crallerl 364 c+a+l+rl NCBI__GCF_000017645.1:WP_012114603.1 371 CDAMLARL 378 *****997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (397 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 19.02 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory