Align Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 (characterized)
to candidate WP_012115812.1 XAUT_RS19440 tRNA glutamyl-Q(34) synthetase GluQRS
Query= SwissProt::Q8DLI5 (485 letters) >NCBI__GCF_000017645.1:WP_012115812.1 Length = 315 Score = 135 bits (339), Expect = 3e-36 Identities = 105/284 (36%), Positives = 135/284 (47%), Gaps = 30/284 (10%) Query: 6 RLAPSPTGNLHIGTARTAVFNWLYARHRGGKFILRIEDTDRERSRPEYTENILEGLQWLG 65 R APSP G LH+G A +A+ N AR GG F+LR+ED D R RPEY IL+ L WLG Sbjct: 20 RFAPSPNGRLHLGHAFSALVNVEAARRMGGTFLLRLEDIDTTRCRPEYARGILDDLSWLG 79 Query: 66 LTWDEGPYFQSDRLDLYRQAIQTLLDKGLAYYCYCTPEELE-ALRAEQKAKGQAPRYDNR 124 + D QSD Y AI L GL Y + + E+ A+ ++ A G+ D Sbjct: 80 VVPDGPVRRQSDHFADYAAAIARLEALGLVYPAFESRSEIAGAVIGQESATGRPAPRDPD 139 Query: 125 HRHLTPEEQAAFEAAGRTPV----IRFKIEDDRQIE---WQDLVRGRVSW---QGADLG- 173 L P +AA A R + F + D D+ G ++W QG G Sbjct: 140 GAPLNPFPRAAMSDAARAALRDQGAPFVVRLDMAASIAAVSDMGGGPLTWEEAQGVPEGP 199 Query: 174 -----------GDMVIARA-APRGEIGYPLYNLVVVVDDIAMGITDVIRGEDHIGNTPKQ 221 GD+V+AR P Y+L VVVDD A GIT VIRG D T Sbjct: 200 RKTVEADAARWGDVVLARKDVPTS------YHLSVVVDDAAQGITHVIRGMDLYHATSVH 253 Query: 222 ILLYEALGATPPNFAHTPLILNSTGQKLSKRDGVTSISDFRAMG 265 +LL LG P + H LIL+ +G KLSK + TS++ RA G Sbjct: 254 VLLQRLLGLPTPIYHHHRLILDDSGYKLSKSNSATSLAALRAAG 297 Lambda K H 0.320 0.136 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 315 Length adjustment: 31 Effective length of query: 454 Effective length of database: 284 Effective search space: 128936 Effective search space used: 128936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory