Align 3-isopropylmalate dehydratase large subunit 1; EC 4.2.1.33; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1 (uncharacterized)
to candidate WP_012115824.1 XAUT_RS19500 aconitate hydratase AcnA
Query= curated2:Q9WYC7 (418 letters) >NCBI__GCF_000017645.1:WP_012115824.1 Length = 898 Score = 122 bits (305), Expect = 6e-32 Identities = 112/398 (28%), Positives = 174/398 (43%), Gaps = 81/398 (20%) Query: 90 KVFDAGDGISHQILAEKYVKP-----------------GDLVAGADSHTCTAGGLGAFGT 132 +V G GI HQ+ E + D + G DSHT GLG G Sbjct: 173 RVVPPGTGICHQVNLEYLAQTVWTRKEELDGKTVTVAYPDTLVGTDSHTTMVNGLGVLGW 232 Query: 133 GMGSTDVAIIFGLGQNW-FKVPETIKVVVNGKLQDGVYAKDIILEIARILGSDGATYKAL 191 G+G + LGQ +PE I ++GKL++G+ A D++L + ++L G K + Sbjct: 233 GVGGIEAEAAM-LGQPISMLIPEVIGFKLSGKLKEGITATDLVLTVTQMLRKKGVVGKFV 291 Query: 192 EFHGSCIENMNVEDRLTISNMAVEVGAKAGLMPSDEKTREFLKKMGREEDFREL------ 245 EF+GS +E++++ DR TI+NMA E GA G P D +T ++L++ GR+E EL Sbjct: 292 EFYGSGLEHLSLADRATIANMAPEYGATCGFFPVDRETIDYLEETGRKESRYELVEKYSK 351 Query: 246 -------KADPDAVYETEIEIDATTLEPLVSLPHYVDNVRKVSE--------VEKEKIKI 290 K PD V+ +E+D T+ P ++ P + +SE +E E K Sbjct: 352 AQGMWRKKDTPDPVFTDTLELDLDTVLPSMAGPKRPQDRVLLSESKTGFLAALEGEFKKP 411 Query: 291 DQ---------------------VFIGTCTNGRLQDLEIALKILEKHG------KHPDVR 323 + I +CTN + IA +L K P V+ Sbjct: 412 GEAAKRVPVAGTDYSVGHGDVVIAAITSCTNTSNPSVLIAAGLLAKAAVKKGLKSKPWVK 471 Query: 324 LIVGPASRKVYMDALEKGIIKKFVELGAAVIPPGCGPCVGIHMGVLGDG----------- 372 + P S+ V G+ + E+G ++ GC C+G + G L + Sbjct: 472 TSLAPGSQVVEGYLKAAGLQEYLDEVGFNLVGFGCTTCIG-NSGPLPEAISEAINKNDLV 530 Query: 373 ERVLSTQNRNFKGRMGNPNAEI-YLASPATAAATAVTG 409 + + NRNF+GR+ NP+ + YLASP A A+ G Sbjct: 531 AGAVISGNRNFEGRV-NPDVKANYLASPPLVVAYALAG 567 Lambda K H 0.318 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 798 Number of extensions: 44 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 418 Length of database: 898 Length adjustment: 37 Effective length of query: 381 Effective length of database: 861 Effective search space: 328041 Effective search space used: 328041 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory