Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_012116516.1 XAUT_RS23015 cystathionine beta-lyase
Query= metacyc::HP_RS00540-MONOMER (380 letters) >NCBI__GCF_000017645.1:WP_012116516.1 Length = 398 Score = 219 bits (557), Expect = 1e-61 Identities = 136/386 (35%), Positives = 208/386 (53%), Gaps = 13/386 (3%) Query: 1 MRMQTKLIHGGISEDATTGAVSVPIYQTSTYRQ---DAIGRHKG-YEYSRSGNPTRFALE 56 +R TK++H G G V+ P+ + ST D + H+G Y Y R GNPT E Sbjct: 15 LRPATKVVHSGRDPKRFDGFVNTPVVRGSTVLSATYDDLIHHRGRYSYGRRGNPTTEGFE 74 Query: 57 ELIADLEGGVKGFAFASGLAGIH-AVFSLLQSGDHVLLGDDVYGGTFRLFNQVLVKNGLS 115 + LEGG SGL+ ++ S+L +GDH+L+ D Y T +QVL + G+ Sbjct: 75 TALRALEGGDGIALTPSGLSACSISLLSVLDAGDHLLMVDTAYRPTRTFCDQVLKRLGVE 134 Query: 116 CTIIDTSDISQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFAT 175 T D S I + I+ NT+A++LE+P + ++ D+ +VA+ G+ T++DNT+AT Sbjct: 135 TTYYDPLVGSGIAELIRDNTRAIFLESPGSQSFEMQDVPAITAVARARGITTLIDNTWAT 194 Query: 176 PYYQNPLLLGADIVAHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGPQDS 235 P + P G DI +GTKY+GGH+D+ G ++ A + IA +G + P D+ Sbjct: 195 PLFFKPHAFGVDISIQAGTKYIGGHADLNLGTISAVGPAWKKVIA-THGTLGITISPDDA 253 Query: 236 WLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRGFSG 295 L RG++TL +R+ HQ++ L VA++L+ P+V RV +P LPT P + + K+ G +G Sbjct: 254 ALGARGLRTLAVRLAHHQRSGLEVAQWLQDRPEVSRVLHPALPTDPGHAIWKRDFTGATG 313 Query: 296 MLSFTLKNDSE--AVAFVESLKLFILGESLGGVESLVGIPAFMTHACIPKTQREAAGIRD 353 + S LK E AF ++L LF +G S GG ESL + C + Sbjct: 314 LFSLILKEVPERAVAAFFDALALFGMGYSWGGYESLA-----IPFDCRDYRTATVWDVEG 368 Query: 354 GLVRLSVGIEHEQDLLEDLEQAFAKI 379 VRL +G+E DL DL+QAFA++ Sbjct: 369 PGVRLHIGLEDVADLKADLDQAFARM 394 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 398 Length adjustment: 30 Effective length of query: 350 Effective length of database: 368 Effective search space: 128800 Effective search space used: 128800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory