Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_012172492.1 AZC_RS20380 branched-chain amino acid aminotransferase
Query= BRENDA::O86428 (307 letters) >NCBI__GCF_000010525.1:WP_012172492.1 Length = 295 Score = 227 bits (578), Expect = 3e-64 Identities = 123/283 (43%), Positives = 171/283 (60%), Gaps = 7/283 (2%) Query: 6 RDGVIWYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYDTPQGTAIFRLQAHTDRLFDS 65 RDG IW DG LV W+DA HVL+H LHY VFEG RAY G IF+ H++RL S Sbjct: 9 RDGWIWMDGALVPWQDAKLHVLSHGLHYASCVFEGERAY----GGTIFKSSEHSERLRLS 64 Query: 66 AHIMNMQIPYSRDEINEATRAAVRENNLESAYIRPMVFYGSEGMGLRASGLKVHVIIAAW 125 A +++ IPYS EI+ A R + +NNL AY+RP+ + GSE MG+ A K+H+ I W Sbjct: 65 AEMLDFTIPYSIAEIDAAKRLTLEKNNLVDAYVRPVAWRGSEMMGVSAQHNKIHLAIGVW 124 Query: 126 SWGAYMGEEALQQGIKVRTSSFTRHHVNISMTRAKSNGAYINSMLALQEAISGGADEAMM 185 W +Y E Q+G+++ + F R +AK++G Y+ ++ +A G +AMM Sbjct: 125 EWPSYFDPEQRQKGLRLDLAEFRRPDPATIPCKAKASGLYMICTISKHKAERRGYADAMM 184 Query: 186 LDPEGYVAEGSGENIFIIKDGVIYTPEVTACLNGITRNTILTLAAEHGFKLVEKRITRDE 245 LD G VAE +G NIF +KDGVI+TP+ L+GITR T++ LA HG+++VE+ I +E Sbjct: 185 LDYRGLVAECTGANIFFVKDGVIHTPKPDCFLDGITRRTVIDLAKRHGYEVVERHIKPEE 244 Query: 246 VYIADEAFFTGTAAEVTPIREVDGRKIGAGRRGPVTEKLQKAY 288 + E F TGTAAEVTP+ E+ K +T +L AY Sbjct: 245 LAGFSECFITGTAAEVTPVGEIAEWKF---TPSGITHQLMDAY 284 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 295 Length adjustment: 27 Effective length of query: 280 Effective length of database: 268 Effective search space: 75040 Effective search space used: 75040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_012172492.1 AZC_RS20380 (branched-chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.26920.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-87 278.2 0.0 4.6e-87 277.9 0.0 1.0 1 lcl|NCBI__GCF_000010525.1:WP_012172492.1 AZC_RS20380 branched-chain amino Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000010525.1:WP_012172492.1 AZC_RS20380 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 277.9 0.0 4.6e-87 4.6e-87 1 282 [. 14 286 .. 14 294 .. 0.97 Alignments for each domain: == domain 1 score: 277.9 bits; conditional E-value: 4.6e-87 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskee 69 w+dG lv+++dak+hvl+h+lhY + vfeG RaY + +if+ +eh eRl sa++l++ ipys e lcl|NCBI__GCF_000010525.1:WP_012172492.1 14 WMDGALVPWQDAKLHVLSHGLHYASCVFEGERAYGG----TIFKSSEHSERLRLSAEMLDFTIPYSIAE 78 9*********************************99....9**************************** PP TIGR01122 70 lvevtkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssf 138 + + + +l knnl +aY+Rp++++G+e +g++++ k++++i +wew+ y++ e +kG++ ++ f lcl|NCBI__GCF_000010525.1:WP_012172492.1 79 IDAAKRLTLEKNNLVDAYVRPVAWRGSEMMGVSAQH-NKIHLAIGVWEWPSYFDPEQRQKGLRLDLAEF 146 **********************************55.5******************************* PP TIGR01122 139 rraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvses 207 rr ++ +ip kaka+g Y+ ++ k++a r+Gy +a++Ld G vae +G nif vkdgv+ tP+ + lcl|NCBI__GCF_000010525.1:WP_012172492.1 147 RRPDPATIPCKAKASGLYMICTISKHKAERRGYADAMMLDYRGLVAECTGANIFFVKDGVIHTPKP-DC 214 *****************************************************************9.99 PP TIGR01122 208 iLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkkl 276 L+gitr +vi+lak++g+ev+e++i eel e f+tGtaaevtP+ e+ + k +t++l lcl|NCBI__GCF_000010525.1:WP_012172492.1 215 FLDGITRRTVIDLAKRHGYEVVERHIKPEELAGFSECFITGTAAEVTPVGEIAEWKFTP---SGITHQL 280 *****************************************************999865...5699999 PP TIGR01122 277 qeaffd 282 ++a+ lcl|NCBI__GCF_000010525.1:WP_012172492.1 281 MDAYTA 286 999976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.74 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory