Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_012172548.1 AZC_RS20660 acetylornithine transaminase
Query= reanno::Koxy:BWI76_RS11670 (406 letters) >NCBI__GCF_000010525.1:WP_012172548.1 Length = 402 Score = 345 bits (885), Expect = 1e-99 Identities = 187/394 (47%), Positives = 245/394 (62%), Gaps = 5/394 (1%) Query: 14 MMPVYAPAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAGKFWH 73 ++P YA RGEG L G+ Y+DF GIAVN LGHA+P L +ALTEQAGK WH Sbjct: 5 VLPTYARINLEFERGEGCWLVTTDGRRYLDFTAGIAVNVLGHANPYLAQALTEQAGKLWH 64 Query: 74 TGNGYTNEPVLRLAKQLIDATFADRVFFCNSGAEANEAALKLARKYAHDRFGSEKSGIVA 133 T N + RLA++L ATFAD VFF NSGAEA E A+K+ARKY + E++ ++A Sbjct: 65 TSNLFRIAGGERLAERLTQATFADTVFFTNSGAEALECAIKMARKYQYVSGHPERNRLIA 124 Query: 134 FKNAFHGRTLFTVSAGGQPAYSQDFAPLPPQIQHAIYNDLDSAKALIDDNTCAVIVEPMQ 193 F+ AFHGRTL T++AGG Y + F P P H + DL++ KA I T +++EP+Q Sbjct: 125 FEGAFHGRTLATIAAGGNAKYLEGFGPELPGFDHVPFGDLEAVKAAIGPATAGILLEPIQ 184 Query: 194 GEGGVVPADADFLRGLRELCDAHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLSTAKA 253 GEGGV + FL LR LCD H LL+ DEVQ+GVGRTG+L+A+ GVTPD++S AK Sbjct: 185 GEGGVRVPPSGFLAALRALCDEHGLLLVLDEVQSGVGRTGKLFAHEWAGVTPDIMSVAKG 244 Query: 254 LGGGFPIGALLASERCASVMTVGTHGTTYGGNPLACAVAGEVFATINTREVLNGVKQRHQ 313 +GGGFP+GA LA+E A MT+GTHG+TYGGNPLA AV V + L V Q Sbjct: 245 IGGGFPMGACLATEEAAKGMTLGTHGSTYGGNPLAMAVGNAVLDKVLEPSFLEHVNQISL 304 Query: 314 WFCERLNAINARY-GLFKEIRGLGLLIGCVLKDEYAGKAKAISNQAAEEGLMILIAGANV 372 F + L + R+ G+ E+RG GLL+G A+ EEGL+ AG NV Sbjct: 305 RFTQLLAGVKDRHPGVIAEVRGQGLLLGLRANVPAGDLVVAL----REEGLLAPGAGDNV 360 Query: 373 VRFAPALIISEDEVNSGLDRFELACKRFLAGVSS 406 VR P L++SE+EV ++ E AC+R G+++ Sbjct: 361 VRLLPPLVVSEEEVKLAAEKIEAACRRIEDGLAA 394 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 471 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 402 Length adjustment: 31 Effective length of query: 375 Effective length of database: 371 Effective search space: 139125 Effective search space used: 139125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory