Align candidate WP_012172861.1 AZC_RS22260 (methionine synthase)
to HMM PF02965 (Met_synt_B12)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF02965.21.hmm # target sequence database: /tmp/gapView.23861.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Met_synt_B12 [M=273] Accession: PF02965.21 Description: Vitamin B12 dependent methionine synthase, activation domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-135 435.0 0.0 1.1e-134 434.1 0.0 1.4 1 lcl|NCBI__GCF_000010525.1:WP_012172861.1 AZC_RS22260 methionine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000010525.1:WP_012172861.1 AZC_RS22260 methionine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 434.1 0.0 1.1e-134 1.1e-134 1 273 [] 951 1223 .. 951 1223 .. 1.00 Alignments for each domain: == domain 1 score: 434.1 bits; conditional E-value: 1.1e-134 Met_synt_B12 1 dleelveyidWtpffqaWelkgkypkiledekvgeeakklfkdAqamLkkiieekllkakavvglfp 67 dl++lv++idW+pff++Wel+gkyp+il+de+vge+a++lf+dAqamLkkii+ek+++akavvg++p lcl|NCBI__GCF_000010525.1:WP_012172861.1 951 DLADLVPFIDWSPFFASWELTGKYPQILQDETVGEAARNLFSDAQAMLKKIIDEKWVTAKAVVGFWP 1017 689**************************************************************** PP Met_synt_B12 68 AnsegddievyadesrseelatlhtLrqqaekeegkpnlclaDfvapkesgvkDyiGlFavtaglgi 134 An++gddi +++de r + latlhtLrqq +++eg++nl+laDfvap esgv+Dy+G+Favtag+g lcl|NCBI__GCF_000010525.1:WP_012172861.1 1018 ANAVGDDILLFRDEGRMTPLATLHTLRQQLARREGRSNLALADFVAPVESGVHDYVGGFAVTAGIGE 1084 ******************************************************************* PP Met_synt_B12 135 eelakefeaekddYsailvkaladrLaeAfaellhekvrkelWgyakdeklsneelikekYqgiRpA 201 ee +++f+a++ddYsail+kal+drLaeAfae++h++vr+e+Wgya de lsne+li+ekY+giRpA lcl|NCBI__GCF_000010525.1:WP_012172861.1 1085 EERTTAFKAANDDYSAILLKALCDRLAEAFAERMHQRVRTEFWGYADDEGLSNEDLIAEKYRGIRPA 1151 ******************************************************************* PP Met_synt_B12 202 pGYpacpdhtekktlfelldaeekigieLteslamtPaasvsGlyfahpearyFavgkiekdqvedy 268 pGYpa+pdhtek tlf+llda++kig+eLtes+am+P a+vsGlyfahpe+ yF+vg+ie+dqvedy lcl|NCBI__GCF_000010525.1:WP_012172861.1 1152 PGYPAQPDHTEKGTLFTLLDATDKIGLELTESFAMWPGAAVSGLYFAHPESAYFGVGRIERDQVEDY 1218 ******************************************************************* PP Met_synt_B12 269 akrkg 273 a+rkg lcl|NCBI__GCF_000010525.1:WP_012172861.1 1219 AARKG 1223 ***97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (273 nodes) Target sequences: 1 (1248 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 18.83 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory