Align Homoserine O-succinyltransferase; HST; EC 2.3.1.46; Homoserine transsuccinylase; HTS (uncharacterized)
to candidate WP_012281269.1 HM1_RS00420 homoserine O-acetyltransferase
Query= curated2:A0LCI7 (394 letters) >NCBI__GCF_000019165.1:WP_012281269.1 Length = 391 Score = 355 bits (910), Expect = e-102 Identities = 183/373 (49%), Positives = 235/373 (63%), Gaps = 8/373 (2%) Query: 11 GIVTPQHVRLFGASTPLQLDGGTLLHSVDVSYETYGTLNQERSNAVLICHALSGNAHAAG 70 GIV PQ S L+ G+ L + V YETYG LN+ERSNA+LI HAL+G+ HAAG Sbjct: 17 GIVQPQTFTFAEGSDAFVLESGSRLGPITVVYETYGVLNRERSNAILIAHALTGDHHAAG 76 Query: 71 YHSKDDKRPGWWDHYIGPGKPFDTNRYFVIASNNLGGCDGTTGPSSIDPATGMPYGLNFP 130 + +K PGWWD IGPGKPFDTNR+F+I SN LGGC GTTGP+SI+PATG PYG+NFP Sbjct: 77 KNHPSEKTPGWWDDLIGPGKPFDTNRFFIICSNVLGGCRGTTGPASINPATGRPYGMNFP 136 Query: 131 MITIGDIVRVQHALVRQLGIERLMAVVGGSMGGMQALQWALDYPHMVPASVIIAAAPRLT 190 + TI D+VRVQ AL+ LGIERL+ V GGSMGGMQ L+W + YP M+ + IA A R+T Sbjct: 137 VYTIRDMVRVQKALIDHLGIERLLLVAGGSMGGMQVLEWGVTYPDMMDGLLPIATAGRMT 196 Query: 191 AQNIAFNAVARQAIMADPHFNGGDYYTLPGDPTTKARPESGLALARMMAHITYLSEQGLH 250 A IAFN + RQ IM DP +NGGDY PG P GLA+ARM+ +TY S++ Sbjct: 197 AMGIAFNEIMRQTIMLDPAWNGGDY--APG-----KGPAQGLAIARMLGMVTYRSDELFT 249 Query: 251 ERFGRRLQDRDALSY-GFETDFAVESYLSYQGSSFVKRFDANSYLYITKAMDYFDPFPDA 309 RFGRR+ + +Y F F +ESYL YQG V+RFDAN+Y+Y+ KAMD D Sbjct: 250 ARFGRRMTNNQPKAYFDFNNRFEIESYLHYQGDKLVRRFDANTYIYLCKAMDLLDVGRGR 309 Query: 310 ETTVQRLTGVESHFLVMSFDTDWRFDTSRSKELVRILHRSLKDCTFQEFSSPAGHDAFLL 369 + L + + L + D+DW + E+ I+ ++ D + E SP GHDAFL+ Sbjct: 310 GGYEKALASITARTLFIGVDSDWLYPPVYMIEMAEIMKKAGCDARYWELKSPHGHDAFLI 369 Query: 370 PHPSYEKSLGSFL 382 + SF+ Sbjct: 370 EFERMRPLVASFV 382 Lambda K H 0.320 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 391 Length adjustment: 31 Effective length of query: 363 Effective length of database: 360 Effective search space: 130680 Effective search space used: 130680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory