Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_012281269.1 HM1_RS00420 homoserine O-acetyltransferase
Query= SwissProt::D3P9D1 (377 letters) >NCBI__GCF_000019165.1:WP_012281269.1 Length = 391 Score = 409 bits (1051), Expect = e-119 Identities = 201/373 (53%), Positives = 258/373 (69%), Gaps = 5/373 (1%) Query: 3 ENSVGLVKTKYVTF---KDDFYFESGRILSPITVAYETYGKLNEKKDNAILICHALTGSA 59 E+ G+V+ + TF D F ESG L PITV YETYG LN ++ NAILI HALTG Sbjct: 13 ESREGIVQPQTFTFAEGSDAFVLESGSRLGPITVVYETYGVLNRERSNAILIAHALTGDH 72 Query: 60 HAAGYNSPDDQKPGWWDDMIGPGKAFDTDKYFIICSNFLGSCYGTTGPASIDPSTGKPYG 119 HAAG N P ++ PGWWDD+IGPGK FDT+++FIICSN LG C GTTGPASI+P+TG+PYG Sbjct: 73 HAAGKNHPSEKTPGWWDDLIGPGKPFDTNRFFIICSNVLGGCRGTTGPASINPATGRPYG 132 Query: 120 LKFPVFTVKDMVKLQKKLIDYLGIEKLLCVAGGSMGGMQALEWAVTFPEKTYSIIPIATA 179 + FPV+T++DMV++QK LID+LGIE+LL VAGGSMGGMQ LEW VT+P+ ++PIATA Sbjct: 133 MNFPVYTIRDMVRVQKALIDHLGIERLLLVAGGSMGGMQVLEWGVTYPDMMDGLLPIATA 192 Query: 180 GRITPMAIAFNTIGRFAIMKDPNWMNGDYYGKTFPRDGLAIARMAGHITYMSDKSFHKKF 239 GR+T M IAFN I R IM DP W GDY P GLAIARM G +TY SD+ F +F Sbjct: 193 GRMTAMGIAFNEIMRQTIMLDPAWNGGDYAPGKGPAQGLAIARMLGMVTYRSDELFTARF 252 Query: 240 GRRYATF--GGIYDFFGYFEVENYLRYNGYKFTERFDANSYLYIIKAMDIFDLSYGYGSY 297 GRR +DF FE+E+YL Y G K RFDAN+Y+Y+ KAMD+ D+ G G Y Sbjct: 253 GRRMTNNQPKAYFDFNNRFEIESYLHYQGDKLVRRFDANTYIYLCKAMDLLDVGRGRGGY 312 Query: 298 EEAIGRIEADSLFITFTSDFLFPSYQTEEIVNIMKNHGKNPEWVNIESDYGHDAFLLEFD 357 E+A+ I A +LFI SD+L+P E+ IMK G + + ++S +GHDAFL+EF+ Sbjct: 313 EKALASITARTLFIGVDSDWLYPPVYMIEMAEIMKKAGCDARYWELKSPHGHDAFLIEFE 372 Query: 358 TQTSCIKEFLSKI 370 + F++++ Sbjct: 373 RMRPLVASFVNEL 385 Lambda K H 0.321 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 391 Length adjustment: 30 Effective length of query: 347 Effective length of database: 361 Effective search space: 125267 Effective search space used: 125267 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_012281269.1 HM1_RS00420 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.31491.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-145 470.5 0.0 2e-145 470.2 0.0 1.0 1 lcl|NCBI__GCF_000019165.1:WP_012281269.1 HM1_RS00420 homoserine O-acetylt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000019165.1:WP_012281269.1 HM1_RS00420 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 470.2 0.0 2e-145 2e-145 3 350 .. 31 382 .. 29 383 .. 0.96 Alignments for each domain: == domain 1 score: 470.2 bits; conditional E-value: 2e-145 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgrald 69 + ++lesG+ l ++v+y+tyG ln+er+Na+l+ Haltg++h+agk++ ++k GWWd+l+Gpg+++d lcl|NCBI__GCF_000019165.1:WP_012281269.1 31 DAFVLESGSRLGPITVVYETYGVLNRERSNAILIAHALTGDHHAAGKNHPSEKtpGWWDDLIGPGKPFD 99 5799*****************************************9988777778************** PP TIGR01392 70 tsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlG 138 t+r+f++c+NvlG+c+G+tgP+sinp+tg+pyg +fP+ tirD+v++qkal+d+Lg+e+l +v GgS+G lcl|NCBI__GCF_000019165.1:WP_012281269.1 100 TNRFFIICSNVLGGCRGTTGPASINPATGRPYGMNFPVYTIRDMVRVQKALIDHLGIERLLLVAGGSMG 168 ********************************************************************* PP TIGR01392 139 GmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeeeqPekGLalARml 207 Gmq+lew ++yp++++ ++++at+ r++a+ iafne++rq+i+ Dp +n+G+ya + P++GLa+ARml lcl|NCBI__GCF_000019165.1:WP_012281269.1 169 GMQVLEWGVTYPDMMDGLLPIATAGRMTAMGIAFNEIMRQTIMLDPAWNGGDYAPGKGPAQGLAIARML 237 *******************************************************9************* PP TIGR01392 208 alltYrseesleerfgreakseeslas.sleeefsvesylryqgkkfverFdAnsYllltkaldthdla 275 +++tYrs+e + +rfgr++++++ a+ ++++f++esyl+yqg+k+v+rFdAn+Y++l ka+d d++ lcl|NCBI__GCF_000019165.1:WP_012281269.1 238 GMVTYRSDELFTARFGRRMTNNQPKAYfDFNNRFEIESYLHYQGDKLVRRFDANTYIYLCKAMDLLDVG 306 ****************99998865544146*************************************** PP TIGR01392 276 rgrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekv 342 rg r+++++al++i+a++l++g++sD+l+++ e+a+ +k+a+ + y e++s++GHDaFl+e+e++ lcl|NCBI__GCF_000019165.1:WP_012281269.1 307 RG-RGGYEKALASITARTLFIGVDSDWLYPPVYMIEMAEIMKKAGCDarYWELKSPHGHDAFLIEFERM 374 **.8**************************************9987777******************** PP TIGR01392 343 eelirefl 350 + l+++f+ lcl|NCBI__GCF_000019165.1:WP_012281269.1 375 RPLVASFV 382 ****9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.48 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory