Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate WP_012281686.1 HM1_RS02470 shikimate kinase
Query= metacyc::MONOMER-21144 (185 letters) >NCBI__GCF_000019165.1:WP_012281686.1 Length = 200 Score = 70.9 bits (172), Expect = 1e-17 Identities = 53/166 (31%), Positives = 81/166 (48%), Gaps = 6/166 (3%) Query: 21 VSIIGMAGAGKTTVGRELALQLGWAHVDTDNLIEATYGTRLQAVADSMDKESFLDVEAGV 80 V +IG G GK+TVGR LA +LG VDTD +E G + + D + F E + Sbjct: 18 VVLIGFMGTGKSTVGRRLAARLGCPFVDTDGEVEKVTGMTIAQIFDRYGEARFRSEERQM 77 Query: 81 IRRIGA-RRTVLSTGGSVVYRHEAMAHLAALGPLVYLDVSLPLILKRIAMNPDRGLAIAP 139 R++ A V++TGG +V E +A L + G L+ L+ + +I R+ R L + Sbjct: 78 ARKVAALEGVVVATGGGIVLNPENVAALRSSGVLIGLEATAEVIWSRVTRRNHRPL-LQK 136 Query: 140 GQTIEDLYNERIALYRRY---ATFTVAADALSPGGCATRIVAWLTG 182 +++ L E +A R Y A TV +LS I+ +L G Sbjct: 137 DSSVDHL-REMMAKRRPYYACADMTVDTSSLSVNEIVEVILTYLRG 181 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 100 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 185 Length of database: 200 Length adjustment: 20 Effective length of query: 165 Effective length of database: 180 Effective search space: 29700 Effective search space used: 29700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory