Align chorismate synthase (EC 4.2.3.5) (characterized)
to candidate WP_012281687.1 HM1_RS02475 chorismate synthase
Query= BRENDA::Q71Y87 (388 letters) >NCBI__GCF_000019165.1:WP_012281687.1 Length = 393 Score = 412 bits (1058), Expect = e-119 Identities = 212/394 (53%), Positives = 277/394 (70%), Gaps = 10/394 (2%) Query: 1 MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITA 60 +RYLTAGESHGP LT I+EG+ AG+PL AED++++L RRQ GHGRG RM IEKD+ I + Sbjct: 4 LRYLTAGESHGPALTVIVEGMVAGLPLKAEDLDEQLARRQKGHGRGGRMAIEKDRAAILS 63 Query: 61 GIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYG 120 GIR GKTLG+P+ + +EN+DWK+W T+M+ E + RRV++PRPGHADL G +KY Sbjct: 64 GIRGGKTLGSPICLQIENRDWKNWSTIMAAGA--EADLMGRRVTQPRPGHADLAGAIKYA 121 Query: 121 HNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLEIGGTRA------NLTRD 174 D+RN+LERSSARET RVAAGAVA++ L ELGI V HV IG A D Sbjct: 122 QRDIRNILERSSARETAARVAAGAVARRFLAELGIGVCSHVTAIGDAAAVGGIIDRTESD 181 Query: 175 YAVSEIQETSEASPVRCLDGVAAEEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQ 234 + + +E S VRC D + M+ ID AK GD++GG++E+ V G+P G+GS+VQ Sbjct: 182 WV--RLAAQAEQSTVRCADSALEQAMISAIDRAKSAGDSLGGVIELAVLGLPVGVGSHVQ 239 Query: 235 WDKKLDAKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGF 294 D++LD +IA A+++I A KG E G+GF AA +PGS+V DEI + +E GY RRTN GG Sbjct: 240 SDRRLDGRIAGAMMAIPAIKGVEIGLGFAAALRPGSQVHDEIGYDRESGYGRRTNRAGGI 299 Query: 295 EGGMTNGMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVV 354 EGG++NG P+VVR MKPIPTLY+PL +VDIDS++ ASVERSD+CAVPAA+VVAEAV+ Sbjct: 300 EGGISNGAPVVVRIAMKPIPTLYQPLMTVDIDSRQPVAASVERSDTCAVPAAAVVAEAVL 359 Query: 355 AWEVAVAVLEKFDGDRFDTLKKHVEEHRNLTKEF 388 A VA ++LE GD +++ V R F Sbjct: 360 ALVVADSLLETTGGDTLAQVRERVAAMREQALRF 393 Lambda K H 0.315 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 393 Length adjustment: 31 Effective length of query: 357 Effective length of database: 362 Effective search space: 129234 Effective search space used: 129234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
Align candidate WP_012281687.1 HM1_RS02475 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.6216.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-126 406.2 1.7 6.4e-126 406.0 1.7 1.0 1 lcl|NCBI__GCF_000019165.1:WP_012281687.1 HM1_RS02475 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000019165.1:WP_012281687.1 HM1_RS02475 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 406.0 1.7 6.4e-126 6.4e-126 1 349 [. 4 372 .. 4 374 .. 0.94 Alignments for each domain: == domain 1 score: 406.0 bits; conditional E-value: 6.4e-126 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 lr++t+GeSHg+al++i++G+ agl+l++ed+ ++l+rR++g++r+ rm E+D+ ilsG++ GkT G lcl|NCBI__GCF_000019165.1:WP_012281687.1 4 LRYLTAGESHGPALTVIVEGMVAGLPLKAEDLDEQLARRQKGHGRGGRMAIEKDRAAILSGIRGGKTLG 72 699****************************************************************** PP TIGR00033 70 aPiallikNkd...........vrskdyedikelpRPgHadytylkKYgikd.regggrsSaReTaarv 126 +Pi+l+i+N+d +++ + ++pRPgHad+++ KY +d r++++rsSaReTaarv lcl|NCBI__GCF_000019165.1:WP_012281687.1 73 SPICLQIENRDwknwstimaagAEADLMGRRVTQPRPGHADLAGAIKYAQRDiRNILERSSARETAARV 141 ***********999999976666666667799************************************* PP TIGR00033 127 aaGavakklLketagieivayvvklgeveleeesak......eiskerldkspvrcpdaeaekemeeei 189 aaGava+++L+e gi + ++v+ +g+ ++ ++ ++++s+vrc+d e++m i lcl|NCBI__GCF_000019165.1:WP_012281687.1 142 AAGAVARRFLAE-LGIGVCSHVTAIGDAAAVGGIIDrtesdwVRLAAQAEQSTVRCADSALEQAMISAI 209 ************.88************776655555455555346778888****************** PP TIGR00033 190 dkakkdgdsvGgvvevvvsnvpvglG..eplfdkldaelasallsinAvKgveiGdGFeaasvrGsean 256 d+ak++gds+Ggv+e+ v ++pvg+G ++ +++ld+++a a+++i+A+KgveiG GF+aa ++Gs+++ lcl|NCBI__GCF_000019165.1:WP_012281687.1 210 DRAKSAGDSLGGVIELAVLGLPVGVGshVQSDRRLDGRIAGAMMAIPAIKGVEIGLGFAAALRPGSQVH 278 **************************777889************************************* PP TIGR00033 257 Delvle.ddkirrktnnsGGieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcv 324 De+ ++ + ++ r+tn+ GGieGGi+nG +++vria+Kpipt+++pl+tvd++ ++++ a+++R+D c+ lcl|NCBI__GCF_000019165.1:WP_012281687.1 279 DEIGYDrESGYGRRTNRAGGIEGGISNGAPVVVRIAMKPIPTLYQPLMTVDIDSRQPVAASVERSDTCA 347 ******999************************************************************ PP TIGR00033 325 vpravpvvEamvalvladallekra 349 vp+a++v+Ea++alv+ad lle ++ lcl|NCBI__GCF_000019165.1:WP_012281687.1 348 VPAAAVVAEAVLALVVADSLLETTG 372 *********************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.90 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory