Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_012281785.1 HM1_RS02935 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::A0A6F8T0V6 (393 letters) >NCBI__GCF_000019165.1:WP_012281785.1 Length = 397 Score = 411 bits (1057), Expect = e-119 Identities = 207/393 (52%), Positives = 276/393 (70%), Gaps = 4/393 (1%) Query: 1 MKLAKRVASLTPSATLAITAKAKELKAAGYDVIGLGAGEPDFNTPQHIIAAAIKTMNEGH 60 M L+K+ S+ PS TL+I AKAK++++ G DVIG GAGEPDF+TP H+ AAI + G Sbjct: 1 MNLSKKGLSIHPSPTLSIDAKAKKMRSEGVDVIGFGAGEPDFDTPDHVKQAAIAAIEAGF 60 Query: 61 TKYTPSGGLPALKEEIIKKFARDQGLSYEPAEIIVCVGAKHALYTLFQVLLDEGDEVIIP 120 TKYTP+ G LK+ I K + G+ Y PA IIV GAKH+L F+ + + GDEVIIP Sbjct: 61 TKYTPASGTLELKQAICDKLKAENGVDYAPANIIVSNGAKHSLVNAFEAICNPGDEVIIP 120 Query: 121 TPYWVSYPEQVKLAGGVPVYVEGLEENDFKMTPDQLKQAITPKTKAVIINSPSNPTGMIY 180 PYWVSYPE VKL VPV+V EE+ FK T +Q+KQA+T KTKA+++NSPSNPTGM+Y Sbjct: 121 APYWVSYPEMVKLVDAVPVFVYTTEESRFKFTVEQIKQALTSKTKALVLNSPSNPTGMVY 180 Query: 181 TAEELKALGEVCLAHGVLIVSDEIYEKLIYGGAKHVSIAELSPELKEQTIIINGVSKSHS 240 + EEL + ++ + +G+ ++SDEIYEKLIY +HVSIA ++ ++KEQTII+NGVSK++S Sbjct: 181 SKEELAEIADLAVEYGIFVISDEIYEKLIYDDFEHVSIASINDKIKEQTIIVNGVSKAYS 240 Query: 241 MTGWRIGYAAGPKDIIQAMTDLASHSTSNPTSIAQYAAIAAYSGPQEPVEQMRQAFEERL 300 MTGWRIGY A I + M ++ SH+TSNP SIAQ AA+AA +GPQ+ V M F R Sbjct: 241 MTGWRIGYTASNAPIAKIMANIQSHATSNPNSIAQKAALAAITGPQDIVGTMVGEFVRRR 300 Query: 301 NIIYDKLVQIPGFTCIKPQGAFYLFPNARK--AADMAGCRT--VDEFVAALLEEAKVALV 356 + + +++ IPG +C+KP GAFY+ N K + AG R D+F LLE+A+VALV Sbjct: 301 DYMVERINAIPGLSCLKPNGAFYVMMNISKIIGSTFAGRRINGSDDFADLLLEQAQVALV 360 Query: 357 PGSGFGAPDYVRLSYATSLEALETAIERIRRFM 389 PGSGFG +VRLSYATS+E + + RI F+ Sbjct: 361 PGSGFGIDTHVRLSYATSMENITEGLNRIENFL 393 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 397 Length adjustment: 31 Effective length of query: 362 Effective length of database: 366 Effective search space: 132492 Effective search space used: 132492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory