Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate WP_012282027.1 HM1_RS04085 fructose-1,6-bisphosphate aldolase, class II
Query= BRENDA::Q9RHA2 (305 letters) >NCBI__GCF_000019165.1:WP_012282027.1 Length = 284 Score = 278 bits (712), Expect = 8e-80 Identities = 150/305 (49%), Positives = 203/305 (66%), Gaps = 24/305 (7%) Query: 2 LVTGLEILKKAREEGYGVGAFNVNNMEFLQAVLEAAEEQRSPVILALSEGAMKYGGRALT 61 LV ++L A E Y VGAFN NNME +QA++ AAE +R+PVI+ S+GA+KY G Sbjct: 3 LVPVSQLLAAAEEGKYAVGAFNCNNMEIVQAIVAAAEAERAPVIIQASQGAIKYAGLEYI 62 Query: 62 LMAVELAKE-ARVPVAVHLDHGSSYESVLRALRAGFTSVMIDKSHEDFETNVRETRRVVE 120 + LA E A VPVA+HLDHG+S+ ++ +R+GFTSVMID S E N+ T RV+E Sbjct: 63 VALARLAGETASVPVALHLDHGTSFAQCIQCIRSGFTSVMIDGSKYPLEENIALTNRVLE 122 Query: 121 AAHAVGVTVEAELGRLAGIEEHVAVDEKDALLTNPEEARIFMERTGADYLAVAIGTSHGA 180 A AVGV+VEAELG++ G E+ + VDE+DA T+P EA+ F++ T D LAVAIGT+HG Sbjct: 123 VARAVGVSVEAELGKIGGTEDDIHVDERDAFFTDPAEAKQFVDATKVDALAVAIGTAHGQ 182 Query: 181 YKGKGRPFIDHARLERIARLVPAPLVLHGASAVPPELVERFRASGGEIGEAAGIHPEDIK 240 Y KGRP +D RL +I +LV P+VLHG+S VP EDI+ Sbjct: 183 Y--KGRPELDFDRLAKIRQLVNIPIVLHGSSGVP---------------------EEDIQ 219 Query: 241 KAISLGIAKINTDTDLRLAFTALIREALNKNPKEFDPRKYLGPAREAVKEVVKSRMELFG 300 KAI+LG+ K+N DT+LR AF ++EA+ KNP+E DPRK LGPA+ + EV++ ++ +FG Sbjct: 220 KAITLGVRKVNIDTNLREAFVDGVKEAIEKNPREIDPRKILGPAKLKMSEVIREKIRIFG 279 Query: 301 SVGRA 305 S G+A Sbjct: 280 SNGKA 284 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 284 Length adjustment: 26 Effective length of query: 279 Effective length of database: 258 Effective search space: 71982 Effective search space used: 71982 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_012282027.1 HM1_RS04085 (fructose-1,6-bisphosphate aldolase, class II)
to HMM TIGR01859 (fba: fructose-1,6-bisphosphate aldolase, class II (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01859.hmm # target sequence database: /tmp/gapView.17461.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01859 [M=282] Accession: TIGR01859 Description: fruc_bis_ald_: fructose-1,6-bisphosphate aldolase, class II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-122 393.7 0.6 3.4e-122 393.5 0.6 1.0 1 lcl|NCBI__GCF_000019165.1:WP_012282027.1 HM1_RS04085 fructose-1,6-bisphos Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000019165.1:WP_012282027.1 HM1_RS04085 fructose-1,6-bisphosphate aldolase, class II # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 393.5 0.6 3.4e-122 3.4e-122 1 282 [] 3 284 .] 3 284 .] 0.98 Alignments for each domain: == domain 1 score: 393.5 bits; conditional E-value: 3.4e-122 TIGR01859 1 lvkakellekakkekYavgafninnlellqaileaaeeeksPvivqvsegavkYlggikvvvalvkali 69 lv + +ll++a+++kYavgafn nn+e++qai+ aae+e++Pvi+q+s+ga+kY+g ++ +val + + lcl|NCBI__GCF_000019165.1:WP_012282027.1 3 LVPVSQLLAAAEEGKYAVGAFNCNNMEIVQAIVAAAEAERAPVIIQASQGAIKYAG-LEYIVALARLAG 70 678899*************************************************9.999999988777 PP TIGR01859 70 eklsivPvalhLDhGssyescikaikaGfssvmiDashlpleenlketkkvveiahakgvsveaelGkl 138 e++s vPvalhLDhG+s+ +ci++i++Gf+svmiD+s++pleen+++t++v+e+a+a gvsveaelGk+ lcl|NCBI__GCF_000019165.1:WP_012282027.1 71 ETAS-VPVALHLDHGTSFAQCIQCIRSGFTSVMIDGSKYPLEENIALTNRVLEVARAVGVSVEAELGKI 138 7777.**************************************************************** PP TIGR01859 139 gGiedd..vvekeaeladideakklvketgvDaLaiaiGtshGkykgepkldferlkeikkllnlPlvl 205 gG+edd v+e++a ++d+ eak++v+ t+vDaLa+aiGt+hG+ykg+p+ldf+rl++i++l+n+P+vl lcl|NCBI__GCF_000019165.1:WP_012282027.1 139 GGTEDDihVDERDAFFTDPAEAKQFVDATKVDALAVAIGTAHGQYKGRPELDFDRLAKIRQLVNIPIVL 207 *****98899*********************************************************** PP TIGR01859 206 hGasGipeeqlkkaiklgiakvnidtdlrlaftaairkvleekkdeydpRkilaparealkevvkekik 274 hG+sG+pee+++kai+lg+ kvnidt+lr af++ +++ +e++ e+dpRkil+pa+ +++ev++eki+ lcl|NCBI__GCF_000019165.1:WP_012282027.1 208 HGSSGVPEEDIQKAITLGVRKVNIDTNLREAFVDGVKEAIEKNPREIDPRKILGPAKLKMSEVIREKIR 276 ********************************************************************* PP TIGR01859 275 vlgsagka 282 ++gs+gka lcl|NCBI__GCF_000019165.1:WP_012282027.1 277 IFGSNGKA 284 ******97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (282 nodes) Target sequences: 1 (284 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory