Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate WP_012282524.1 HM1_RS06545 acetylornithine transaminase
Query= curated2:Q5JFW3 (362 letters) >NCBI__GCF_000019165.1:WP_012282524.1 Length = 432 Score = 243 bits (620), Expect = 7e-69 Identities = 139/378 (36%), Positives = 208/378 (55%), Gaps = 20/378 (5%) Query: 5 RKRLRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFE 64 R + LV+G+G +WD GR YLD +AG+ VN LGH HP+ V + +Q ++ ++ Sbjct: 20 RLPISLVKGQGARLWDADGREYLDFLAGLAVNSLGHCHPKVVDALQQQAATLLHVSNLYW 79 Query: 65 HDEREEMLEELSHWVDYEYVYMGNSGTEAVEAAIKFARL------ATGRSEIVAMTNAFH 118 + + ++ + L + V+ NSG EA E AIK AR + + EI+ M +FH Sbjct: 80 IEPQVQLAQVLVENSFADKVFFCNSGAEANEGAIKLARKYAKKTWGSDKYEIITMEKSFH 139 Query: 119 GRTLGSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAITKETAAVIFEPIQGEGGIV 178 GRTL +++AT + KY++ + PL GF+++PF +++A + AI+ T A++ EP+QGEGG+ Sbjct: 140 GRTLATVTATAQPKYQKDYEPLPQGFRYVPFGDLKALERAISPHTCAILVEPVQGEGGVN 199 Query: 179 PADEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYGVRPDIVTMGKGIGNGFP 237 A+ F + L L LLI DEVQ GL RTGK A EHYGV P I+T+ K + G P Sbjct: 200 LAEPSFWQGLAKLAAANKLLLIFDEVQCGLGRTGKLFAHEHYGVTPHIMTLAKALAGGAP 259 Query: 238 VSLTLTDLEIPR----GKHGSTFGGNPLACRAVATTLRILRRDRLVEKAGEKFMEFSGER 293 + L ++ G H STFGGNPL A + +L D L++ E F G Sbjct: 260 MGALLATDDVANAFQPGDHASTFGGNPLVAAAAVAVMDVLLNDGLMDNCREMAAYFMGHL 319 Query: 294 ---------VVKTRGRGLMIGIVLRRPAGNYVKALQERGILVNTAGNRVIRLLPPLIIEG 344 + + RG GLM+ L RP + V E+G+++N V+R LPPLII Sbjct: 320 RRLQEKYPFITEVRGLGLMVACELDRPGADIVANCLEKGLIINCTAGNVLRFLPPLIINK 379 Query: 345 DTLEEARKEIEGVLNDIL 362 ++EA +E VL ++ Sbjct: 380 ADVDEAVAVLEEVLASVV 397 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 432 Length adjustment: 31 Effective length of query: 331 Effective length of database: 401 Effective search space: 132731 Effective search space used: 132731 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory