Align Cystathionine gamma-synthase; CGS; EC 2.5.1.48; O-succinylhomoserine (thiol)-lyase (uncharacterized)
to candidate WP_012282805.1 HM1_RS07785 cystathionine gamma-synthase
Query= curated2:Q1M0P5 (380 letters) >NCBI__GCF_000019165.1:WP_012282805.1 Length = 377 Score = 398 bits (1022), Expect = e-115 Identities = 202/377 (53%), Positives = 260/377 (68%) Query: 1 MHMQTKLIHGGISEDATTGAVSVPIYQTSTYRQDAIGHHKGYEYSRSGNPTRFALEELIA 60 MH+ + L GG +DA TGAVS PIYQ++T+R A+G G++YSRSGNPTR LEELIA Sbjct: 1 MHIDSLLAQGGNGKDAGTGAVSFPIYQSATFRHPALGESTGFDYSRSGNPTRQVLEELIA 60 Query: 61 DLEGGVKGFAFASGLAGIHAVFSLLQSGDHVLLGDDVYGGTFRLFNKVLVKNGLSCTIID 120 LEGG +G AF+SGLA I AV SL GDH++L +D+YGGT+RL +V GL+ ++ Sbjct: 61 KLEGGRRGLAFSSGLAAITAVISLFGPGDHLILCEDLYGGTYRLLEQVFRPWGLTADYVN 120 Query: 121 TSDLSQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFATPYYQN 180 TSD Q+ A+ TKA+++ETP+NP +KITDL + + D GLL IVDNTF +PY Q Sbjct: 121 TSDPEQVNAAVTSRTKAIFIETPTNPTMKITDLREIRRICDDGGLLLIVDNTFISPYLQR 180 Query: 181 PLLLGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGPQDSWLLQR 240 P+ GADIV+HSGTKYLGGH+DVVAGL E L ++AF+QNA G VLGP DSWLL R Sbjct: 181 PIECGADIVIHSGTKYLGGHNDVVAGLAVAAREDLGDKLAFYQNASGAVLGPFDSWLLVR 240 Query: 241 GIKTLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRGFSGMLSFT 300 G+KTLGLR+ Q+NA +A +L HP V++VYY GL HP E+ +Q G GM+SFT Sbjct: 241 GMKTLGLRLDRAQENASAIARWLASHPAVDQVYYIGLDNHPGREVHFQQASGPGGMISFT 300 Query: 301 LKNDSEATPFVESLKLFILGESLGGVESLVGVPAFMTHACIPKTQREAAGIRDGLVRLSV 360 L + + + ++L ESLGGVESL+ PA TH IP+ R G+ D L+RLSV Sbjct: 301 LHDAGKVPEVLSRIQLISFAESLGGVESLLTFPARQTHGDIPEDIRRRCGVTDCLLRLSV 360 Query: 361 GIEHEQDLLEDLEQAFA 377 GIE+ DL++DL QA A Sbjct: 361 GIENVHDLIDDLAQALA 377 Lambda K H 0.318 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 377 Length adjustment: 30 Effective length of query: 350 Effective length of database: 347 Effective search space: 121450 Effective search space used: 121450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory