Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_012284031.1 HM1_RS13875 histidinol-phosphate transaminase
Query= curated2:Q24QJ1 (360 letters) >NCBI__GCF_000019165.1:WP_012284031.1 Length = 418 Score = 296 bits (759), Expect = 5e-85 Identities = 166/358 (46%), Positives = 229/358 (63%), Gaps = 16/358 (4%) Query: 10 WMRPSIRTLKAYESKSIPDCVRLDANENPLPWPPGMIEQLLGSDIA---FNRYPDGGAQE 66 W+R IR + Y++K P+ V++DANENP PWP +E+L D+A F+RYPDG A++ Sbjct: 7 WVRQDIRHIVPYQAKVYPEGVKVDANENPFPWPASYVEKLQ-KDLAAYPFSRYPDGEAKD 65 Query: 67 LKEALSRYTGVPAEGILTGNGSDELIQLLMTTFGGEKGAVVIHPPTFSMYEAAARVTGTG 126 L++ALS YTG IL NGSDE IQL++ TFGG A VI PTF MY A R G Sbjct: 66 LRQALSAYTGRDPAEILISNGSDEAIQLILLTFGGPGLATVISNPTFVMYAMATRYMGGQ 125 Query: 127 VLEVPLLLTETGRDFRLDVEGMLKAAAQPQVHMIVLCNPNNPTGTLFPREEILRIVAESG 186 V++VPLL E FRLDVEG+L AA++ + +I++CNPNNPTG F E+I+ ++ + Sbjct: 126 VIDVPLL--EEAGTFRLDVEGLLSAASREESRVIIICNPNNPTGNSFAEEDIVAVLRGTD 183 Query: 187 KIVIVDEAYGEFSGESVVDQIPYCPNLLVMKTFSKLFAMAALRLGYLLGQPSIIGALNRA 246 KIVIVDEAY EF G+S+V +I PNL+VM+TFSK FA+A LR+GY + +II +++ Sbjct: 184 KIVIVDEAYYEFYGKSMVGRIGEFPNLIVMRTFSKAFALAGLRVGYTMASRAIINEIHKV 243 Query: 247 RQPFNVNSFSQKAGAIALNYGKEYAEQGRILTAELAKIVEALTAFASVKVFATRANFVL- 305 RQPFNVN+FSQ++ AIAL + Q + + AE ++ L F VF T AN+V Sbjct: 244 RQPFNVNAFSQRSAAIALEERAAFENQVKTILAERETLLPQLKRF-DWDVFPTDANYVFL 302 Query: 306 -FQPEDP-------DRVYQELIGKGFLIRNMGNLPLVGKALRLSAGSPEDNERLIKAL 355 + E P +++ L+ +G LIR +G P + LR++ G PE+N RLI AL Sbjct: 303 RLRGESPAARAALAASIHKALMDRGVLIRKLGGGPSLDGTLRITVGQPEENRRLIVAL 360 Lambda K H 0.319 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 418 Length adjustment: 30 Effective length of query: 330 Effective length of database: 388 Effective search space: 128040 Effective search space used: 128040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012284031.1 HM1_RS13875 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.16106.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-104 334.5 0.0 3.8e-104 334.3 0.0 1.0 1 lcl|NCBI__GCF_000019165.1:WP_012284031.1 HM1_RS13875 histidinol-phosphate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000019165.1:WP_012284031.1 HM1_RS13875 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 334.3 0.0 3.8e-104 3.8e-104 1 348 [. 9 362 .. 9 363 .. 0.96 Alignments for each domain: == domain 1 score: 334.3 bits; conditional E-value: 3.8e-104 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk..klhrYpdpqalelkealaky 67 r++i+++ pYq+ + e vk ++nEnPf+ + + +e+l++ l+ ++ rYpd +a++l++al++y lcl|NCBI__GCF_000019165.1:WP_012284031.1 9 RQDIRHIVPYQA--K--VYPEGVKVDANENPFPWPASYVEKLQKDLAayPFSRYPDGEAKDLRQALSAY 73 799*********..3..33369************************9999******************* PP TIGR01141 68 lgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplked...gqedl 133 +g ++++il++nGsde+i+l++ +f pg a+++++pt+ mY++ ++ g +v+ vpl e+ ++ d+ lcl|NCBI__GCF_000019165.1:WP_012284031.1 74 TGRDPAEILISNGSDEAIQLILLTFGGPGLATVISNPTFVMYAMATRYMGGQVIDVPLLEEagtFRLDV 142 **********************************************************99999999999 PP TIGR01141 134 eavle.aakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypn 201 e +l a e+ +++ +++PnnPtGn++ +e+i++vl + d +V+vDeAY+eF ++ s++ + e+pn lcl|NCBI__GCF_000019165.1:WP_012284031.1 143 EGLLSaASREESRVIIICNPNNPTGNSFAEEDIVAVLRGT-DKIVIVDEAYYEFYGK-SMVGRIGEFPN 209 999886888999***************************9.9**************7.*********** PP TIGR01141 202 lvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkker 270 l+v+rT+SKaf+LAglRvGy++a+ +ii++++kvr+p+nv+ ++ a al++++ +e++v+ + +er lcl|NCBI__GCF_000019165.1:WP_012284031.1 210 LIVMRTFSKAFALAGLRVGYTMASRAIINEIHKVRQPFNVNAFSQRSAAIALEERAAFENQVKTILAER 278 ********************************************************************* PP TIGR01141 271 erlleelkkleglevyeSkaNFvlikvke........daeelleallekgiivRdlksaeglleeclRi 331 e ll +lk + + +v++ +aN+v+++++ a+ + +al+++g+++R+l+ ++ l++ lRi lcl|NCBI__GCF_000019165.1:WP_012284031.1 279 ETLLPQLKRF-DWDVFPTDANYVFLRLRGespaaraaLAASIHKALMDRGVLIRKLGGGPS-LDGTLRI 345 **********.69**************99999887666778899**************987.6****** PP TIGR01141 332 tvGtreenerllealke 348 tvG++een+rl+ al++ lcl|NCBI__GCF_000019165.1:WP_012284031.1 346 TVGQPEENRRLIVALEK 362 *************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (418 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.67 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory