Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_012330837.1 M446_RS04185 acetylglutamate kinase
Query= BRENDA::Q87EL2 (421 letters) >NCBI__GCF_000019365.1:WP_012330837.1 Length = 304 Score = 111 bits (278), Expect = 3e-29 Identities = 87/289 (30%), Positives = 143/289 (49%), Gaps = 23/289 (7%) Query: 4 AKEISQYLKRFSQLDAKRFAVVKVGGAVLRDDVDA--LTSSLSFLQEVGLTPIVLHGAGP 61 A+ + Q L + D + V+K GG + D A + L++ GL P+++HG GP Sbjct: 16 AEVLVQALPHMQRYD-EEIVVIKYGGHAMGDRAAAEDFAEDVVLLEQSGLKPVIVHGGGP 74 Query: 62 QLDEELTAVGIQKKTVNGFRVTLPETMAIVRKVFHAT-NLQLIEALQRNGARATSITGG- 119 Q+ L +GI+ + G RVT T+ +V V + N Q++ + G +A + G Sbjct: 75 QIGRMLDRLGIKSEFREGLRVTDAATVEVVEMVLAGSINKQIVGWISAEGGKAIGLCGKD 134 Query: 120 -------------VFEAHYLDQET-YGLVGGISAVNIAPIEASLRAASIPVIASLGETPS 165 V L++E GLVG VN A ++A L+A IPV+A + Sbjct: 135 GNMVQARRATRTVVDPDSNLEREVDLGLVGEPERVNRAVLDAVLKAELIPVLAPVAVGSD 194 Query: 166 GQILNINADVAANELVHVLQPYKIIFLTGTGGLLDADGKIINSINLSTEYEQLIQQPWVY 225 GQ N+NAD A + L+ +++ LT G+LD + K+I +++ + +L+ + Sbjct: 195 GQTYNVNADTFAGAIAGALRAKRLLLLTDVPGVLDKNKKLIPELSVE-DCRRLVADGTIT 253 Query: 226 GGMKLKIEQIKHLLDRLPLESSVSITR--PADLAKELFTHKGSGTLIRR 272 GGM KIE + +++ +E+ V + P + ELFT G+GTLIRR Sbjct: 254 GGMIPKIETCIYAIEQ-GVEAVVILDGKVPHAVLLELFTDYGAGTLIRR 301 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 304 Length adjustment: 29 Effective length of query: 392 Effective length of database: 275 Effective search space: 107800 Effective search space used: 107800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory