Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_012334105.1 M446_RS20920 aminotransferase class V-fold PLP-dependent enzyme
Query= BRENDA::P74281 (384 letters) >NCBI__GCF_000019365.1:WP_012334105.1 Length = 397 Score = 255 bits (651), Expect = 2e-72 Identities = 147/384 (38%), Positives = 214/384 (55%), Gaps = 6/384 (1%) Query: 4 KQMLMIPGPTPVPEKVLLAMAKHPIGHRSGDFSKIIAELTANLKWLHQTENDVLMLTTSG 63 + L IPGPT VP +L A A+ I HRS +F ++ E+ A +K + +TEN VL+ SG Sbjct: 7 RHFLQIPGPTNVPLPILAATARPVIDHRSAEFGQLGREVLAGIKTIFKTENPVLIYAASG 66 Query: 64 TGAMEASIINFLSPGDRVLVGNNGKFGDRWVKVAKTFGLAVEEIKAEWGKALDPNDFKTL 123 TG E++++N L GDRVL+ G F W ++A+ L E I+ +W +D + Sbjct: 67 TGGWESALVNTLQAGDRVLMYETGHFAALWERMARKLSLKPEFIRGDWRSGVDVAAIEAH 126 Query: 124 LEADSDKTIKALIITHSETSTGVLNDLAAINAAAKAHG-GALMIVDAVTSLGATPVAIDD 182 L D IKA+ I H+ET+TG L+D+ + AA G AL++VD ++SLG+T D Sbjct: 127 LAGDRQHGIKAVCIVHNETATGTLSDVQGVRAALDRTGHPALLMVDTISSLGSTDYRHDA 186 Query: 183 LGLDVVASGSQKGYMIPPGLGFVSVSAKAWQAYETATIPRFYLDLKKYKKSTDEDSSPFT 242 G+DV GSQKG M+PPGL F +VS KA A AT+PR Y D + + P T Sbjct: 187 WGVDVTVGGSQKGLMLPPGLAFNAVSDKALAASRQATLPRAYWDWEDMLAANRTGYFPQT 246 Query: 243 PPINLMYGLQASLQMMKAEGLDAIFTRHQRHTNATRGAMK--ALNLPLFAPDNAASNAIT 300 P INL+YGL+ +++ + AEGLDA+F RH R ATR A++ P A+ T Sbjct: 247 PAINLLYGLKVAIETLHAEGLDAVFARHARAAAATRAAVRHWGFETQCAVPAQASPTVTT 306 Query: 301 AVAPLGVEAEKIRSTMRKKFDIAMAGGQDHLKGKIFRIGHLGFVCDRDILSCIGALEATL 360 P G A+ R+ + ++F++A+ G L ++FRIGH+G D + L+ GAL Sbjct: 307 VRMPEGHSADAFRALVLERFNMALGSGLGPLADRVFRIGHIG---DFNDLTIAGALAGVE 363 Query: 361 IELGYEGVTPGSGVAAAAGVLAKG 384 + L G+ +G AA A + G Sbjct: 364 MGLAAAGIPHRAGGAAVAQAILGG 387 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 397 Length adjustment: 31 Effective length of query: 353 Effective length of database: 366 Effective search space: 129198 Effective search space used: 129198 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory