Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate WP_012334196.1 M446_RS21395 cysteine synthase A
Query= BRENDA::C4ITG6 (334 letters) >NCBI__GCF_000019365.1:WP_012334196.1 Length = 327 Score = 427 bits (1099), Expect = e-124 Identities = 213/320 (66%), Positives = 257/320 (80%), Gaps = 3/320 (0%) Query: 16 SKDAEAAGRGRIYDSILDTIGNTPLVRIDKFARENGVKANLLVKLEFFNPLASVKDRIGL 75 S A G GR++ SI +TIGNTPLVR+++ RE GV+A +L+KLEFFNP+ASVKDRIG+ Sbjct: 9 SDTGRAPGHGRVFGSITETIGNTPLVRLNRLPRERGVEAEILLKLEFFNPIASVKDRIGV 68 Query: 76 AMIEALEKQGKAVPGKTVFVEPTSGNTGIALAFAAAAKGYRLILTMPETMSMERRKLLRL 135 MI+ALE G PG T+ VEPTSGNTGIALAF AAA+GYRLIL MPETMS+ERRK+L Sbjct: 69 NMIDALEASGDLKPGGTL-VEPTSGNTGIALAFVAAARGYRLILVMPETMSLERRKMLAF 127 Query: 136 LGAELVLTEGAKGMKGAIAEAEAIGN--PNAIIPQQFENPANPEIHRLTTAEEIWNDTNG 193 LGAELVLT G +GMKGA+A+AE + P +++PQQF NPANPEIHR TTAEEIWNDT G Sbjct: 128 LGAELVLTPGPQGMKGAVAKAEELLREIPGSVMPQQFNNPANPEIHRKTTAEEIWNDTQG 187 Query: 194 EADILISGIGTGGTITGVGQVIKARKPSFKVVAVEPKDSPVLSGGAPGPHKIQGLGAGFA 253 D+ +SG+GTGGTITGVGQV+K R P ++VAVEP+DSPVLSGG PGPHKIQG+GAGF Sbjct: 188 RLDVFVSGVGTGGTITGVGQVLKPRLPQLRLVAVEPEDSPVLSGGNPGPHKIQGIGAGFV 247 Query: 254 PKTLDTGIYDEIVQISNEDAFTNARLVARLEGIPVGISSGAALAAAIEVGKRSENAGKNI 313 P LD + DE+V +SN+ AF ARL+ RLEGIP GIS+GA +AAA+E+G R EN GK I Sbjct: 248 PNVLDRDVIDEVVTVSNQTAFETARLLGRLEGIPGGISTGANVAAALEIGARPENRGKRI 307 Query: 314 VVVIPSFAERYLSTALFEGL 333 V V SFAERY+S+ALF+G+ Sbjct: 308 VTVACSFAERYISSALFDGI 327 Lambda K H 0.314 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 327 Length adjustment: 28 Effective length of query: 306 Effective length of database: 299 Effective search space: 91494 Effective search space used: 91494 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_012334196.1 M446_RS21395 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.1172199.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-138 445.7 0.0 4.5e-138 445.5 0.0 1.0 1 NCBI__GCF_000019365.1:WP_012334196.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000019365.1:WP_012334196.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 445.5 0.0 4.5e-138 4.5e-138 1 298 [] 24 324 .. 24 324 .. 0.98 Alignments for each domain: == domain 1 score: 445.5 bits; conditional E-value: 4.5e-138 TIGR01139 1 iseliGntPlvrLn...laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGi 70 i+e+iGntPlvrLn ++ +++ae+l+kle++nP +svkdri+++mi e +g lk+g t+ve+tsGntGi NCBI__GCF_000019365.1:WP_012334196.1 24 ITETIGNTPLVRLNrlpRERGVEAEILLKLEFFNPIASVKDRIGVNMIDALEASGDLKPGGTLVEPTSGNTGI 96 689***********876678999************************************************** PP TIGR01139 71 alamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqfenpa 143 ala+vaaargy+lil+mpetmslerrk+l +GaelvLt+g +gmkga++kaeel++e p + +++qf+npa NCBI__GCF_000019365.1:WP_012334196.1 97 ALAFVAAARGYRLILVMPETMSLERRKMLAFLGAELVLTPGPQGMKGAVAKAEELLREIPGSV-MPQQFNNPA 168 ************************************************************666.********* PP TIGR01139 144 npeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsggkpgphkiqG 216 npeihrktta+ei++d++g+ld+fv+gvGtGGtitGvg+vlk p++++vaveP++spvlsgg+pgphkiqG NCBI__GCF_000019365.1:WP_012334196.1 169 NPEIHRKTTAEEIWNDTQGRLDVFVSGVGTGGTITGVGQVLKPRLPQLRLVAVEPEDSPVLSGGNPGPHKIQG 241 ************************************************************************* PP TIGR01139 217 igagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle.kdkkivvilpdt 288 igagf+P+vLd++videv++vs+++a+etar l + eGi Gis+Ga+vaaal++ ++e ++k+iv++++++ NCBI__GCF_000019365.1:WP_012334196.1 242 IGAGFVPNVLDRDVIDEVVTVSNQTAFETARLLGRLEGIPGGISTGANVAAALEIGARPEnRGKRIVTVACSF 314 *******************************************************999998************ PP TIGR01139 289 gerYlstaLf 298 +erY+s aLf NCBI__GCF_000019365.1:WP_012334196.1 315 AERYISSALF 324 ********99 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (327 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 13.07 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory