Align histidinol-phosphate aminotransferase [EC:2.6.1.9] (characterized)
to candidate WP_012334967.1 M446_RS25345 histidinol-phosphate transaminase
Query= reanno::azobra:AZOBR_RS20485 (364 letters) >NCBI__GCF_000019365.1:WP_012334967.1 Length = 370 Score = 365 bits (936), Expect = e-105 Identities = 189/360 (52%), Positives = 246/360 (68%), Gaps = 7/360 (1%) Query: 8 PAPRPGILDIAPYVGGEHAGHI-----RLASNEGALGPSPRAVEAYRAAAGELHRYPDGG 62 P PRPG+L I YV G+ A +L+SNE LGPSP AV A R A L YPDG Sbjct: 7 PVPRPGVLAIEAYVPGKSAAPAGVKLHKLSSNETPLGPSPAAVAAMRETASHLELYPDGS 66 Query: 63 SAKLRKAIAERFGLDADRVVCGAGSDELIALLIRAYAGPGDEVLYSQHGFLMYPIGAKSV 122 +A LR+AIA ++GLD R+VCGAGSDEL++LL A+ GPGDE +YS++GFL+Y I + Sbjct: 67 AAALRRAIAGKYGLDPARIVCGAGSDELLSLLTYAFMGPGDEGIYSEYGFLVYRIAILAA 126 Query: 123 GATPVQAPETNLTTDVDSLLAHVTPRTRLVFVANPNNPTGTYITADEMARLHAGLPENAI 182 G TPV APE + T DVD++LA VTPRTR+V++ANPNNPTGTY+ DE+ RLHAGLP + + Sbjct: 127 GGTPVVAPERDHTADVDAILAAVTPRTRIVYLANPNNPTGTYLPFDEVRRLHAGLPGDVL 186 Query: 183 LVIDAAYAEYMNHNDYSAGQELVDRFPNVVMTRTFSKIFALGSVRLGWAYCPAGIADVLN 242 LV+DAAYAEY+ NDY+AG ELV NVVMTRTFSK + L ++R+GW P +AD +N Sbjct: 187 LVLDAAYAEYVRRNDYAAGLELVAESENVVMTRTFSKAYGLAALRIGWMVAPPAVADAVN 246 Query: 243 RVRGPFNVSSAAQIAGVAALEDTAFLERSRSHNIEWREWFVQQVHGLGLKTHPSVTNFVL 302 R+RGPFN+ S A AG AA+ D A + + +HN EW + + +GL PSV NFVL Sbjct: 247 RIRGPFNLGSPAIAAGAAAVADDAHIAAAVAHNEEWLPKVTRALTEIGLSVTPSVGNFVL 306 Query: 303 VDFAGQTAGKDDAEAARLFLKGRGILVRQMPAYGLPSCLRVTIGTEAEMREVVQALKDFL 362 + F G+ AE A FL RG+++R++ AYGLP LR+TIG+ V+ AL+ F+ Sbjct: 307 IHFP-DAPGRGAAE-ADAFLTARGLILRRVAAYGLPHALRMTIGSAEANEAVIAALRAFV 364 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 370 Length adjustment: 30 Effective length of query: 334 Effective length of database: 340 Effective search space: 113560 Effective search space used: 113560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_012334967.1 M446_RS25345 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.3795225.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-88 281.6 0.0 4.3e-88 281.5 0.0 1.0 1 NCBI__GCF_000019365.1:WP_012334967.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000019365.1:WP_012334967.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 281.5 0.0 4.3e-88 4.3e-88 1 348 [. 10 362 .. 10 363 .. 0.95 Alignments for each domain: == domain 1 score: 281.5 bits; conditional E-value: 4.3e-88 TIGR01141 1 rekikklepYqpgarelgek.evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylgvee 72 r+ + ++e+Y+pg+++ + + kL+snE P+gps+++++a++e++++l++Ypd +a++l++a+a ++g+++ NCBI__GCF_000019365.1:WP_012334967.1 10 RPGVLAIEAYVPGKSAAPAGvKLHKLSSNETPLGPSPAAVAAMRETASHLELYPDGSAAALRRAIAGKYGLDP 82 5678899******66655555799************************************************* PP TIGR01141 73 enillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavleaakekvk 145 + i+ g+Gsdel++ll+ af+ pgd+ +++e+ + +Y++ +ag + +p +++ + d++a+l+a++ +++ NCBI__GCF_000019365.1:WP_012334967.1 83 ARIVCGAGSDELLSLLTYAFMGPGDEGIYSEYGFLVYRIAILAAGGTPVVAPERDH-TADVDAILAAVTPRTR 154 ***************************************99999888888887777.59************** PP TIGR01141 146 lvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeypnlvvlrTlSKafgL 214 +v+la+PnnPtG++l +e++++ + d+l V+D AY e+ ++ a lel+ae +n+v++rT+SKa+gL NCBI__GCF_000019365.1:WP_012334967.1 155 IVYLANPNNPTGTYLPFDEVRRLHAGLpGDVLLVLDAAYAEYVRRndyAAGLELVAESENVVMTRTFSKAYGL 227 ***************************77**************998888899********************* PP TIGR01141 215 AglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkererlleelkkleglevye 287 A+lR+G ++a +++++a++++r p+n+ s+a +a+ aa+ d+++i++ v+++++ ++ +l+++ gl+v + NCBI__GCF_000019365.1:WP_012334967.1 228 AALRIGWMVAPPAVADAVNRIRGPFNLGSPAIAAGAAAVADDAHIAAAVAHNEEWLPKVTRALTEI-GLSVTP 299 ******************************************************************.8***** PP TIGR01141 288 SkaNFvlikvke....daeelleallekgiivRdlksaeglleeclRitvGtreenerllealke 348 S +NFvli+++ a+e+ l+ +g+i+R ++++ gl +++lR+t+G++e ne++++al+ NCBI__GCF_000019365.1:WP_012334967.1 300 SVGNFVLIHFPDapgrGAAEADAFLTARGLILRRVAAY-GL-PHALRMTIGSAEANEAVIAALRA 362 ***********987766677777799**********99.85.********************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 30.11 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory