Align phosphoserine aminotransferase monomer (EC 2.6.1.52; EC 2.6.1.1) (characterized)
to candidate WP_012336037.1 M446_RS30960 phosphoserine transaminase
Query= metacyc::MONOMER-15918 (370 letters) >NCBI__GCF_000019365.1:WP_012336037.1 Length = 390 Score = 442 bits (1136), Expect = e-129 Identities = 219/376 (58%), Positives = 267/376 (71%), Gaps = 12/376 (3%) Query: 2 KPTRVPKNPCFSSGPCAKHPGYSVEELKDTPFGRSHRSKPGKEKLAEAIKRTRDMLGLPD 61 +P P+ P FSSGPCAK PG++ L D GRSHR+K GK KL +AI TR +L +PD Sbjct: 4 RPDARPRAPFFSSGPCAKRPGWTPAALSDAALGRSHRAKLGKAKLKQAIDLTRTVLQVPD 63 Query: 62 DYFVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDTRVFEAEY 121 DY +GIVPASDTGA EM +WS+LG R V++L WESF +GW TD KQL+L D RV A Y Sbjct: 64 DYRIGIVPASDTGAVEMAMWSLLGPRPVEMLAWESFGEGWVTDAVKQLRL-DARVTTAPY 122 Query: 122 GKLPDLKKVDFKN-DVVFVWNGTTSGVKVPNADWIPDDREGVTLCDATSAIFAMDIPYHK 180 G LPDL VD ++ DVVF WNGTTSGV+VP+ADWI DREGV +CDATSA FA D+ + K Sbjct: 123 GALPDLAAVDTRHHDVVFTWNGTTSGVRVPDADWIAADREGVVICDATSAAFAQDLDWAK 182 Query: 181 LDVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKDIFAGS 240 LD +TFSWQKVLGGE AHGMLILSPRA RLES+ PAWP+PKIFR+TKGGKL + +F G Sbjct: 183 LDAVTFSWQKVLGGEAAHGMLILSPRAAARLESHVPAWPMPKIFRMTKGGKLIEGLFEGE 242 Query: 241 TINTPSMLANEDWLATLKWAESVGGLKQLIRRTNENLAVFEAFVAKNNWIHFLAETKEIR 300 TINTPSMLA ED++ L WA+ +GGL L R + N V A+VA+ W+ LA Sbjct: 243 TINTPSMLAVEDYIDALLWAQGIGGLPALRARADANARVIAAWVARTPWVENLARAPATA 302 Query: 301 SSTSVCFKV----------DLSDEKLKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATV 350 S+TSVC + + K + TLE+E VA D+G+YRDAP+GLRIWCGATV Sbjct: 303 SNTSVCLVIADPEVTGRGPEAVAALAKGIAATLEREGVALDVGAYRDAPAGLRIWCGATV 362 Query: 351 EKEDLECLCEWIEWAY 366 E+ DLE L W++WA+ Sbjct: 363 ERSDLEALTPWLDWAF 378 Lambda K H 0.319 0.136 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 489 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 390 Length adjustment: 30 Effective length of query: 340 Effective length of database: 360 Effective search space: 122400 Effective search space used: 122400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012336037.1 M446_RS30960 (phosphoserine transaminase)
to HMM TIGR01365 (phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01365.hmm # target sequence database: /tmp/gapView.8683.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01365 [M=374] Accession: TIGR01365 Description: serC_2: phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-199 646.6 1.3 7.5e-199 646.4 1.3 1.0 1 lcl|NCBI__GCF_000019365.1:WP_012336037.1 M446_RS30960 phosphoserine trans Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000019365.1:WP_012336037.1 M446_RS30960 phosphoserine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 646.4 1.3 7.5e-199 7.5e-199 1 373 [. 8 380 .. 8 381 .. 0.99 Alignments for each domain: == domain 1 score: 646.4 bits; conditional E-value: 7.5e-199 TIGR01365 1 rpanpefssgpcakrpgysveelknaalgrshrsklgkeklkeaiektrevlevpadyligivaasdtg 69 rp p fssgpcakrpg+++ +l +aalgrshr+klgk+klk+ai+ tr vl+vp+dy+igiv+asdtg lcl|NCBI__GCF_000019365.1:WP_012336037.1 8 RPRAPFFSSGPCAKRPGWTPAALSDAALGRSHRAKLGKAKLKQAIDLTRTVLQVPDDYRIGIVPASDTG 76 6999***************************************************************** PP TIGR01365 70 avemalwsllgargvdllafesfgkgwvtdvtkqlklkdvrvleaeygklpdlkkvdf.kkdvvftwng 137 avema+wsllg r+v++la+esfg+gwvtd +kql+l d rv a+yg lpdl+ vd ++dvvftwng lcl|NCBI__GCF_000019365.1:WP_012336037.1 77 AVEMAMWSLLGPRPVEMLAWESFGEGWVTDAVKQLRL-DARVTTAPYGALPDLAAVDTrHHDVVFTWNG 144 ************************************9.89*****************8357******** PP TIGR01365 138 ttsgvrvpngdfipadreglticdatsaafaqdldyekldvvtfswqkvlggegahgvlilspravarl 206 ttsgvrvp++d+i+adreg+ icdatsaafaqdld+ kld vtfswqkvlgge ahg+lilspra arl lcl|NCBI__GCF_000019365.1:WP_012336037.1 145 TTSGVRVPDADWIAADREGVVICDATSAAFAQDLDWAKLDAVTFSWQKVLGGEAAHGMLILSPRAAARL 213 ********************************************************************* PP TIGR01365 207 esytpawplpkifrltkggklskdifegetintpsmlavedaldalkwaesigglkalvaraddnlavl 275 es+ pawp+pkifr+tkggkl++++fegetintpsmlaved++dal wa+ iggl al arad+n++v+ lcl|NCBI__GCF_000019365.1:WP_012336037.1 214 ESHVPAWPMPKIFRMTKGGKLIEGLFEGETINTPSMLAVEDYIDALLWAQGIGGLPALRARADANARVI 282 ********************************************************************* PP TIGR01365 276 eafvaksswvdflaatkeirsntsvclkvvdpdvaaldedaqadfakelvsalekegvaydigsyrdap 344 +a+va+++wv+ la +++ sntsvcl ++dp+v+ +a a +ak+++ +le+egva+d+g+yrdap lcl|NCBI__GCF_000019365.1:WP_012336037.1 283 AAWVARTPWVENLARAPATASNTSVCLVIADPEVTGRGPEAVAALAKGIAATLEREGVALDVGAYRDAP 351 ********************************************************************* PP TIGR01365 345 aglriwcgatveksdleallewldwafal 373 aglriwcgatve+sdleal++wldwafa lcl|NCBI__GCF_000019365.1:WP_012336037.1 352 AGLRIWCGATVERSDLEALTPWLDWAFAQ 380 ***************************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (374 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 9.55 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory