Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; EC 3.5.1.18; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase (uncharacterized)
to candidate WP_012336174.1 M446_RS31645 acetylornithine deacetylase
Query= curated2:A5FYQ7 (371 letters) >NCBI__GCF_000019365.1:WP_012336174.1 Length = 389 Score = 64.3 bits (155), Expect = 5e-15 Identities = 77/259 (29%), Positives = 108/259 (41%), Gaps = 31/259 (11%) Query: 66 AGHTDVVPP-GEGWRHDPFAAVIEDGLLFGRGAVDMKGAIAAFVAALAAR-PANHAGTIS 123 +GHTDVV P G+ W DPF + +G L GRGAVDMKG A + + A+ A I Sbjct: 74 SGHTDVVSPAGQDWTSDPFRLRLAEGRLHGRGAVDMKGFCALCLGLVPEMLAADLARPIH 133 Query: 124 LLITGDEEG---DAVDGTRRILDHLAASGALPEFCLVGEPTCRARLGDTIKIGRRGSISA 180 LL++ DEE VD R L GA+ +VGEPT G + + + Sbjct: 134 LLLSYDEETTCLGVVDAIARFGIDLPRPGAV----IVGEPT-----GLEVADAHKSVATF 184 Query: 181 HVTVRGVQGHVAYPHLADNPL---HRLIPALEALRATTLDEG--TAWFEPS-SLQITSVD 234 TV G + H + P L N + L+ L + + G + F+P S V Sbjct: 185 VTTVLGHEAHSSKPALGANAVMAAAELVAELNRIADELIARGDPSGRFDPPYSTVHVGVI 244 Query: 235 TGNKAGNVIPASASARLNIRFNDRHTGPDLAAWIRDTVARHAPGAACDIGISGEAFLTEP 294 G N++P + R PDL D V R AA + L Sbjct: 245 GGGTVRNILPGRCTFEWEFR-----GLPDLDL---DEVPRRFAAAAETV---ARERLNRF 293 Query: 295 GPVTTLFSEAVAAVTGITP 313 GP + + A+V G++P Sbjct: 294 GPYGRIETVRDASVPGLSP 312 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 26 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 389 Length adjustment: 30 Effective length of query: 341 Effective length of database: 359 Effective search space: 122419 Effective search space used: 122419 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory