Align Imidazole glycerol phosphate synthase subunit HisF; EC 4.3.2.10; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF (uncharacterized)
to candidate WP_012336410.1 M446_RS32890 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Query= curated2:Q8ESS2 (254 letters) >NCBI__GCF_000019365.1:WP_012336410.1 Length = 253 Score = 98.6 bits (244), Expect = 1e-25 Identities = 73/223 (32%), Positives = 111/223 (49%), Gaps = 11/223 (4%) Query: 6 IIPCLDVDNGR---VVKGKKFLDIQDVADPVELAKRYNDEGADELVFYDITASNEQRGIF 62 + P +D+ GR +V+G I DP A + +G L D+ + + Sbjct: 6 LFPAIDLKEGRCVRLVQGDMAQAIVFSDDPAAQAATFAAQGFSWLHVVDLDGAFAGAPMN 65 Query: 63 LDVVEKVAKEIAIPFMVGGGIRTTKDIHQVLRSGADKVSINSAAVQRPELIFESAQKFGS 122 V+ + +AIP +GGGIR + + L G +V I +AAV+ P + E+A++F Sbjct: 66 AAAVDAILAAVAIPVQLGGGIREMRTVEGWLGKGVSRVIIGTAAVRDPAFVREAARRFPG 125 Query: 123 QCTVLSIDAKEIAVGKWNVFINGGRKDTGIDAIEWAKKGESYGAGEIVVNAMDADGEKNG 182 + V IDAK+ GK V + G K + + A E ++ E G I+ + DG G Sbjct: 126 KIAV-GIDAKD---GK--VAVEGWAKTSTVTADELGRRFEDAGVAAIIYTDIARDGVLKG 179 Query: 183 YNLPLTTAIATAVNIPVIASGGAGNIQHFKDVLSHEIDAALAA 225 N+P+T A+A AV+IPVIASGG +I +L E D AL A Sbjct: 180 LNIPMTLALAQAVSIPVIASGGLASIADIHRLL--EPDCALLA 220 Lambda K H 0.317 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory