Align threonine deaminase (EC 4.3.1.19) (characterized)
to candidate WP_012336455.1 M446_RS33115 threonine ammonia-lyase
Query= reanno::Caulo:CCNA_03750 (400 letters) >NCBI__GCF_000019365.1:WP_012336455.1 Length = 413 Score = 424 bits (1090), Expect = e-123 Identities = 215/391 (54%), Positives = 279/391 (71%), Gaps = 1/391 (0%) Query: 8 IQAAAGRLQGQIERTPCRHSKTLSKITGAEVWVKFENLQFTAAYKERGALNKLMLLSETE 67 + AA ++G + RTP + LS++TGA V+VK EN+Q T A+KERGA N+L L E Sbjct: 12 VARAAETIRGHVLRTPLVPAPRLSEVTGARVFVKHENMQATGAFKERGAANRLSRLDADE 71 Query: 68 KQRGVIAASAGNHAQGLAYHGARLGVPVTIVMPKTTPFVKVQHTRDFGATVVIEGETYDD 127 ++RGV+A SAGNHAQ +AYH RLG+P TIVMP TTP VKV++TR GATV++EGET + Sbjct: 72 RRRGVVAMSAGNHAQAVAYHARRLGIPATIVMPATTPLVKVENTRAHGATVLLEGETLVE 131 Query: 128 ANAHARKLRDEQGLTFVHPFDDYDIMAGQGTIALEMLEDAPDLEILPVPIGGGGLISGVA 187 A AR L + +GL VHP+DD +MAGQGT+ALEMLEDAPDL+ L VPIGGGGL++G+A Sbjct: 132 AAETARDLVETRGLVLVHPYDDPAVMAGQGTVALEMLEDAPDLDCLVVPIGGGGLMAGMA 191 Query: 188 TAAKALKPDIRIIGCEPAMYPSFTAKMRGVAAHCGGQTIAEGVAVKQVGELTYGVVRPLL 247 AA A +PD+ + G E A YPSF + G A GG T+AEG+AVK VG T ++R + Sbjct: 192 VAASA-RPDLDLYGVEAAFYPSFLNAIDGGARPIGGPTLAEGIAVKTVGRFTLPIIRDRV 250 Query: 248 DDVLLLEEPYLEQAVSLYCNVEKTIAEGAGAASLAALLAYPERFRGKKCGLILCGGNIDT 307 ++LL+ EP +E+AV Y +++++AEGAGAA LAALLA+P+RF G+K GL+LCGGNID Sbjct: 251 REILLVGEPEIERAVHDYATLQRSLAEGAGAAGLAALLAHPDRFAGRKVGLVLCGGNIDA 310 Query: 308 RLLASVLTRELVRAQRLASLRIIGDDRPGLLSTVASVIGAMGANIIEVNHNRLALDVPAK 367 RLLASV+ REL R R+ S R+ DRPG+L V +G +G NI+EV+H RL LDVPAK Sbjct: 311 RLLASVMVRELEREDRIVSFRLTASDRPGVLGRVTGRLGELGVNILEVSHGRLHLDVPAK 370 Query: 368 GAEFDITIETRDAQHTQEVMEALRESGYPPR 398 D+TIETR HT E++ L G PR Sbjct: 371 SVTIDVTIETRGPGHTAEILTTLAAEGLDPR 401 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 413 Length adjustment: 31 Effective length of query: 369 Effective length of database: 382 Effective search space: 140958 Effective search space used: 140958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory