Align histidinol-phosphate aminotransferase [EC:2.6.1.9] (characterized)
to candidate WP_012383319.1 BIND_RS01560 histidinol-phosphate aminotransferase
Query= reanno::azobra:AZOBR_RS20485 (364 letters) >NCBI__GCF_000019845.1:WP_012383319.1 Length = 378 Score = 383 bits (984), Expect = e-111 Identities = 192/359 (53%), Positives = 246/359 (68%), Gaps = 9/359 (2%) Query: 8 PAPRPGILDIAPYVGGEHAGH-----IRLASNEGALGPSPRAVEAYRAAAGELHRYPDGG 62 P P G+L I PYV G+ A +L+SNE LGPSP A +A+ A+A +L YPDG Sbjct: 15 PMPHAGVLGIEPYVPGKSAAPGVAKIHKLSSNETPLGPSPEAQKAFAASAEKLALYPDGA 74 Query: 63 SAKLRKAIAERFGLDADRVVCGAGSDELIALLIRAYAGPGDEVLYSQHGFLMYPIGAKSV 122 + LR AIA R GLD R+VCGAGSDEL++LL Y GPG+E ++++HGFL+Y I + Sbjct: 75 ATLLRTAIASRHGLDPARIVCGAGSDELLSLLAAVYLGPGEEGIFTEHGFLVYKIAILTA 134 Query: 123 GATPVQAPETNLTTDVDSLLAHVTPRTRLVFVANPNNPTGTYITADEMARLHAGLPENAI 182 G TP+ PE +LTTDVD++LA VTPRTR+V++ANPNNPTGTY+ E+ RL LP N + Sbjct: 135 GGTPIVVPEKDLTTDVDAILAAVTPRTRIVYIANPNNPTGTYLPFAEVKRLATSLPPNVL 194 Query: 183 LVIDAAYAEYMNHNDYSAGQELVDRFPNVVMTRTFSKIFALGSVRLGWAYCPAGIADVLN 242 LV+DAAY EY+ NDYSAG ELV NVVMTRTFSKI+ L ++RLGW Y P +AD LN Sbjct: 195 LVLDAAYGEYVTRNDYSAGLELVSTHENVVMTRTFSKIYGLAALRLGWCYAPLAVADALN 254 Query: 243 RVRGPFNVSSAAQIAGVAALEDTAFLERSRSHNIEWREWFVQQVHGLGLKTHPSVTNFVL 302 RVRGPFN S A GVAAL D A ++R+ +HN W W +++ LG K PSV NF+L Sbjct: 255 RVRGPFNTSGPAIATGVAALADQAHIDRAIAHNETWLSWLGEEIGKLGFKVTPSVANFLL 314 Query: 303 VDFAGQTAGKDDAEAARLFLKGRGILVRQMPAYGLPSCLRVTIGTEAEMREVVQALKDF 361 + F Q +A+A FL RG+++R + +YGLP+CLR+T+GTE R VV LKDF Sbjct: 315 LHFEDQA----EAQAVDAFLSSRGLILRAVASYGLPNCLRLTVGTEEANRLVVDGLKDF 369 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 378 Length adjustment: 30 Effective length of query: 334 Effective length of database: 348 Effective search space: 116232 Effective search space used: 116232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_012383319.1 BIND_RS01560 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.31725.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-87 279.3 0.0 2.2e-87 279.1 0.0 1.0 1 lcl|NCBI__GCF_000019845.1:WP_012383319.1 BIND_RS01560 histidinol-phosphat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000019845.1:WP_012383319.1 BIND_RS01560 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 279.1 0.0 2.2e-87 2.2e-87 4 347 .. 21 367 .. 18 369 .. 0.95 Alignments for each domain: == domain 1 score: 279.1 bits; conditional E-value: 2.2e-87 TIGR01141 4 ikklepYqpgarelgek.evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylgve 71 + +epY+pg+++ ++ ++ kL+snE P+gps+++++a+ ++++kl +Ypd a+ l++a+a++ g++ lcl|NCBI__GCF_000019845.1:WP_012383319.1 21 VLGIEPYVPGKSAAPGVaKIHKLSSNETPLGPSPEAQKAFAASAEKLALYPDGAATLLRTAIASRHGLD 89 56789*****88888886888************************************************ PP TIGR01141 72 eenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavleaa 140 ++ i+ g+Gsdel++ll+ +l pg++ +++e+ + +Y++ +ag + vp k+ + d++a+l+a+ lcl|NCBI__GCF_000019845.1:WP_012383319.1 90 PARIVCGAGSDELLSLLAAVYLGPGEEGIFTEHGFLVYKIAILTAGGTPIVVPEKDL-TTDVDAILAAV 157 *********************************************999999998777.69********* PP TIGR01141 141 kekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeypnlvvl 205 + ++++v++a+PnnPtG++l +e+++++ + ++l V+D AY+e+ ++ lel++ ++n+v++ lcl|NCBI__GCF_000019845.1:WP_012383319.1 158 TPRTRIVYIANPNNPTGTYLPFAEVKRLATSLpPNVLLVLDAAYGEYVTRndySAGLELVSTHENVVMT 226 ********************************66**************998877789************ PP TIGR01141 206 rTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkererll 274 rT+SK++gLA+lR+G +a ++++al++vr p+n+s +a +++vaal d+++i + +++++ +l lcl|NCBI__GCF_000019845.1:WP_012383319.1 227 RTFSKIYGLAALRLGWCYAPLAVADALNRVRGPFNTSGPAIATGVAALADQAHIDRAIAHNETWLSWLG 295 ********************************************************************* PP TIGR01141 275 eelkkleglevyeSkaNFvlikvke..daeelleallekgiivRdlksaeglleeclRitvGtreener 341 ee+ kl g++v +S aNF+l++++ +a+++ l +g+i+R ++s+ gl ++clR+tvGt+e n+ lcl|NCBI__GCF_000019845.1:WP_012383319.1 296 EEIGKL-GFKVTPSVANFLLLHFEDqaEAQAVDAFLSSRGLILRAVASY-GL-PNCLRLTVGTEEANRL 361 ******.8***************9875666666778899**********.85.**************99 PP TIGR01141 342 llealk 347 +++ lk lcl|NCBI__GCF_000019845.1:WP_012383319.1 362 VVDGLK 367 998776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (378 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.89 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory