Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_012383400.1 BIND_RS01975 threonine-phosphate decarboxylase
Query= curated2:Q311Z4 (383 letters) >NCBI__GCF_000019845.1:WP_012383400.1 Length = 336 Score = 83.2 bits (204), Expect = 1e-20 Identities = 72/216 (33%), Positives = 102/216 (47%), Gaps = 14/216 (6%) Query: 100 VVTGNGSDEVIDLIIRVKARPGKHNIVAFNPCFSMYELQTRFCGVEFRQVPLRADFSFDY 159 +V GS +I + R+ GK + P + + + +R V R D Sbjct: 72 IVAAPGSQALIQALPRLHRLDGKPS-----PRIGILGMTYAEHALNWRAVGARVQEDMDL 126 Query: 160 DAFVGAADADTAVAFITTPDNPSGYCPPVEEIIDLARRLPS-SCLLVVDEAYMDFADDPA 218 DA A VA + P+NP G P ++DLA RL LL+VDEA+MDF + P Sbjct: 127 DAL-----ATMDVAIVVNPNNPDGRLLPPAALLDLAARLSKHGGLLIVDEAFMDF-EAPE 180 Query: 219 AHSVLPHLTEFPNVAVLRTFSKSYGLAGLRLGFGVMHPALADYVKRVRLPFSINILAEYA 278 H V P + E V VLR+F K+YGL GLRLGF + P LA ++ P++++ A Sbjct: 181 THFV-PVMPE-NGVLVLRSFGKAYGLGGLRLGFALTGPKLAADLRAWFGPWAVSGPAIAI 238 Query: 279 GIAALQDTTFHAQTLRVTREGRTYLTGALTEAGCTV 314 G AL D+ + + + T L L EAG V Sbjct: 239 GRQALGDSLWLVEARKRLETMGTALDRLLCEAGFAV 274 Lambda K H 0.322 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 336 Length adjustment: 29 Effective length of query: 354 Effective length of database: 307 Effective search space: 108678 Effective search space used: 108678 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory