Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_012384038.1 BIND_RS05265 O-succinylhomoserine sulfhydrylase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000019845.1:WP_012384038.1 Length = 408 Score = 379 bits (973), Expect = e-110 Identities = 198/392 (50%), Positives = 263/392 (67%), Gaps = 1/392 (0%) Query: 13 DLEGAAFDTLAVRAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRYTN 72 D EG T V G R+P GE EA+F T YV+ T A ARF GE PG VYSRY N Sbjct: 9 DPEGWRTATRLVHGGTTRSPFGETAEAIFLTQGYVYPTMEAAEARFKGEEPGFVYSRYNN 68 Query: 73 PTVRTFEERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKY 132 PT FEER+A LEGAE A ATASGM+A+ A +++ +GDHV+ SR++FGS + + ++ Sbjct: 69 PTNAMFEERMALLEGAEAARATASGMAAVTAALLAPLKAGDHVVASRALFGSCLYIVEEL 128 Query: 133 FKRFGIQVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLA 192 R+GI D AW+ A +P T+ F+ESP+NP E+ DIAA+A IAHA GA L Sbjct: 129 LPRYGIASTLVDGKDFKAWKDALRPQTQTLFLESPTNPSLEVYDIAAVAAIAHAHGARLV 188 Query: 193 VDNCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMK-EVVGFLRTAGP 251 VDN F +P LQ+PL+LGAD V++SATK+IDGQGR +GGVV + ++ + +LR GP Sbjct: 189 VDNAFASPMLQKPLQLGADCVVYSATKHIDGQGRCLGGVVLSSKDFIETHLQTYLRQTGP 248 Query: 252 TLSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARR 311 LSPFNAW+ LK LETL +R+Q A+A +A++L P I R +Y G HPQ E+ +R Sbjct: 249 ALSPFNAWILLKSLETLPLRVQQQMANAAKVADFLADHPLIARCFYPGRADHPQAEIVKR 308 Query: 312 QQSGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRA 371 Q G G +V+F+V GG+ AA+ F +A ++ I+ NLGD K+ I HPATT+H RL+PE RA Sbjct: 309 QMLGGGTMVAFEVTGGKPAAFAFANALSIIKISNNLGDAKSLITHPATTTHQRLTPEARA 368 Query: 372 RAGIGDSLIRVAVGLEDLDDLKADMARGLAAL 403 GIG+ L+R++VGLED +DL AD+ LA L Sbjct: 369 TMGIGEGLLRLSVGLEDAEDLIADLQAALAVL 400 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 408 Length adjustment: 31 Effective length of query: 372 Effective length of database: 377 Effective search space: 140244 Effective search space used: 140244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory